Index of /

[ICO]NameLast ModifiedSize

[TXT]Poverty Alleviation Programmes Under The Plans2010-01-02T09:03:00+00:00 23 MB 
[TXT]Veda and Bharat2010-01-03T06:22:00+00:00 18 MB 
[TXT]The Japu Ji Sahib2010-01-04T03:41:00+00:00 17 MB 
[TXT]Shahjahan's Delhi Past and Present2010-01-05T01:00:00+00:00 21 MB 
[TXT]Empowerment of Women in India 1st Edition2010-01-05T22:19:00+00:00 25 MB 
[TXT]Health and Family Welfare Public Policy and People's Participation in India 1st2010-01-06T19:38:00+00:00 19 MB 
[TXT]Researches in Archaeological and Conservation 1st Edition2010-01-07T16:57:00+00:00 22 MB 
[TXT]Human Rights in Pre-Trial Detention2010-01-08T14:16:00+00:00 22 MB 
[TXT]Children's Libraries2010-01-09T11:35:00+00:00 21 MB 
[TXT]South Indian Archaeology 1st Edition2010-01-10T08:54:00+00:00 22 MB 
[TXT]Organised Transnational Crimes2010-01-11T06:13:00+00:00 24 MB 
[TXT]My City was Gone One American Town's Toxic Secret, its Angry Band of Locals and a $2010-01-12T03:32:00+00:00 25 MB 
[TXT]C.S. Lewis A Complete Guide to His Life & Works2010-01-13T00:51:00+00:00 18 MB 
[TXT]The Screwtape Letters With Screwtape Proposes a Toast2010-01-13T22:10:00+00:00 23 MB 
[TXT]The Disinherited Exile and the Making of Spanish Culture, 1492-19752010-01-14T19:29:00+00:00 17 MB 
[TXT]Peaches2010-01-15T16:48:00+00:00 25 MB 
[TXT]A Personal Matter2010-01-16T14:07:00+00:00 18 MB 
[TXT]Island Girls (and Boys) 1st Avon Edition2010-01-17T11:26:00+00:00 24 MB 
[TXT]The Wish (rack)2010-01-18T08:45:00+00:00 17 MB 
[TXT]Lying in Weight The Hidden Epidemic of Eating Disorders in Adult Women 1st Edition2010-01-19T06:04:00+00:00 17 MB 
[TXT]Shuffle Up and Deal The Ultimate No Limit Texas Hold em Guide2010-01-20T03:23:00+00:00 21 MB 
[TXT]The Body in the Gallery A Faith Fairchild Mystery2010-01-21T00:42:00+00:00 24 MB 
[TXT]The Patricia Cornwell CD Audio Treasury Low Price Contains all that Remains and Cruel and Unusual2010-01-21T22:01:00+00:00 22 MB 
[TXT]Spice Flavors of the Eastern Mediterranean2010-01-22T19:20:00+00:00 19 MB 
[TXT]Im Sorry2010-01-23T16:39:00+00:00 25 MB 
[TXT]Overcoming Underearning A Five-Step Plan to a Richer Life2010-01-24T13:58:00+00:00 17 MB 
[TXT]The Color of Blood2010-01-25T11:17:00+00:00 17 MB 
[TXT]A Short History of the United States2010-01-26T08:36:00+00:00 22 MB 
[TXT]Hating Women America's Hostile Campaign Against the Fairer Sex2010-01-27T05:55:00+00:00 17 MB 
[TXT]Shattered Silk2010-01-28T03:14:00+00:00 24 MB 
[TXT]Back to the Bedroom LP2010-01-29T00:33:00+00:00 24 MB 
[TXT]The Wit & Wisdom of Winston Churchill2010-01-29T21:52:00+00:00 24 MB 
[TXT]Love, Again2010-01-30T19:11:00+00:00 20 MB 
[TXT]The Name of the World A Novel2010-01-31T16:30:00+00:00 23 MB 
[TXT]Resurrecting Sex Solving Sexual Problems and Revolutionizing Your Relationship2010-02-01T13:49:00+00:00 19 MB 
[TXT]Ghosts of Manila The Fateful Blood Feud Between Muhammad Ali and Joe Frazier2010-02-02T11:08:00+00:00 25 MB 
[TXT]Giant2010-02-03T08:27:00+00:00 18 MB 
[TXT]Kobe The Story of the NBA's Rising Young St2010-02-04T05:46:00+00:00 23 MB 
[TXT]Poppy and Ereth2010-02-05T03:05:00+00:00 21 MB 
[TXT]Just Wicked Enough2010-02-06T00:24:00+00:00 20 MB 
[TXT]The Dance of the Dissident Daughter A Woman&2010-02-06T21:43:00+00:00 19 MB 
[TXT]The Reptile Room Or, Murder!2010-02-07T19:02:00+00:00 18 MB 
[TXT]Identity by Design Tradition, Change, and Celebration in Native Women&am2010-02-08T16:21:00+00:00 23 MB 
[TXT]Avalon High: Coronation No.3 Hunter&2010-02-09T13:40:00+00:00 25 MB 
[TXT]Distant Heart2010-02-10T10:59:00+00:00 22 MB 
[TXT]Twenty Years Crisis, 1919-19392010-02-11T08:18:00+00:00 23 MB 
[TXT]Guide to Toy Collecting2010-02-12T05:37:00+00:00 24 MB 
[TXT]The Glory Days New York Baseball2010-02-13T02:56:00+00:00 18 MB 
[TXT]Real Live Boyfriends: Yes. Boyfriends, plural. If my life werent complicated, I wouldnt be Ruby O2010-02-14T00:15:00+00:00 18 MB 
[TXT]Red Glass2010-02-14T21:34:00+00:00 18 MB 
[TXT]The Memories: JFK 1961-19632010-02-15T18:53:00+00:00 20 MB 
[TXT]The Perfect Storm A True Story of Men Against the Sea2010-02-16T16:12:00+00:00 25 MB 
[TXT]Deep Survival Who Lives, who Dies, and why2010-02-17T13:31:00+00:00 22 MB 
[TXT]Making Globalization Work2010-02-18T10:50:00+00:00 17 MB 
[TXT]The Seminar of Jacques Lacan, Book 17 The other Side of Psychoanalysis2010-02-19T08:09:00+00:00 18 MB 
[TXT]The Return of Depression Economics and the Crisis of 20082010-02-20T05:28:00+00:00 22 MB 
[TXT]The American2010-02-21T02:47:00+00:00 18 MB 
[TXT]Newtonian Mechanics2010-02-22T00:06:00+00:00 21 MB 
[TXT]Facing Shame: Families in Recovery2010-02-22T21:25:00+00:00 20 MB 
[TXT]Everybody Says Freedom: A History of the Civil Rights Movement in Songs and Pictures2010-02-23T18:44:00+00:00 25 MB 
[TXT]Post Captain2010-02-24T16:03:00+00:00 21 MB 
[TXT]The House by the Sea A Journal2010-02-25T13:22:00+00:00 20 MB 
[TXT]Michaelangelo: The Sistine Chapel Ceiling (Norton Critical Studies in Art History)2010-02-26T10:41:00+00:00 19 MB 
[TXT]The Commodore2010-02-27T08:00:00+00:00 25 MB 
[TXT]Lost Opportunity What Has Made Economic Reform in Russia So Difficult?2010-02-28T05:19:00+00:00 20 MB 
[TXT]The Impeachment and Trial of Andrew Johnson2010-03-01T02:38:00+00:00 22 MB 
[TXT]Yellow: Stories2010-03-01T23:57:00+00:00 21 MB 
[TXT]The Annotated Hans Christian Andersen (The Annotated Books)2010-03-02T21:16:00+00:00 20 MB 
[TXT]The Annotated Wind in the Willows (The Annotated Books)2010-03-03T18:35:00+00:00 25 MB 
[TXT]3 Willows The Sisterhood Grows2010-03-04T15:54:00+00:00 25 MB 
[TXT]Going Bovine2010-03-05T13:13:00+00:00 24 MB 
[TXT]Micro A Novel2010-03-06T10:32:00+00:00 24 MB 
[TXT]From Resistance to Revolution Colonial Radicals and the Development of American Opposition to Brita2010-03-07T07:51:00+00:00 25 MB 
[TXT]Understanding Ambedkar 1st Edition2010-03-08T05:10:00+00:00 18 MB 
[TXT]India A Reference Annual - 19992010-03-09T02:29:00+00:00 20 MB 
[TXT]John Rawls Concept of Justice Rawat Ideas & Thinkers in Social Science2010-03-09T23:48:00+00:00 22 MB 
[TXT]Acrylics in 10 Steps2010-03-10T21:07:00+00:00 19 MB 
[TXT]Asterix Omnibus 3, Asterix and the Big Fight, Asterix in Britain and Asterix and the Normans 3 Vols.2010-03-11T18:26:00+00:00 24 MB 
[TXT]Blackveil2010-03-12T15:45:00+00:00 22 MB 
[TXT]Labels2010-03-13T13:04:00+00:00 21 MB 
[TXT]The Reading Promise 3,218 Nights Of Reading With My Father2010-03-14T10:23:00+00:00 22 MB 
[TXT]Kingfisher Readers Where Animals Live2010-03-15T07:42:00+00:00 21 MB 
[TXT]Welcome to Friendship A Course That Empowers Young People to Discover the Need For and Value of Pos2010-03-16T05:01:00+00:00 23 MB 
[TXT]Battling the Hamster Wheel (TM) Strategies for Making High School Reform Work2010-03-17T02:20:00+00:00 21 MB 
[TXT]What Every Principal Should Know About Operational Leadership2010-03-17T23:39:00+00:00 21 MB 
[TXT]A Federal Offense A Novel2010-03-18T20:58:00+00:00 24 MB 
[TXT]Answers A User's Guide to Retirement2010-03-19T18:17:00+00:00 19 MB 
[TXT]Seven Out2010-03-20T15:36:00+00:00 25 MB 
[TXT]The Cat Arches Her Back2010-03-21T12:55:00+00:00 20 MB 
[TXT]Woman Vanishes2010-03-22T10:14:00+00:00 19 MB 
[TXT]"The Internet Hero Darc Fyber is the iHero&2010-03-23T07:33:00+00:00 23 MB 
[TXT]Something at The Center2010-03-24T04:52:00+00:00 22 MB 
[TXT]Christmas Stories from the Jersey Cape2010-03-25T02:11:00+00:00 24 MB 
[TXT]Lord Given Lovers The Holy Union of David & Jonathan2010-03-25T23:30:00+00:00 20 MB 
[TXT]Inside the Sun Journey through the Heart of Your Nearest Star2010-03-26T20:49:00+00:00 25 MB 
[TXT]Dana Dale's Diary A Year in the Life of an Oversexed British Housewife2010-03-27T18:08:00+00:00 21 MB 
[TXT]Audio Cassette Odyssey's The Curse of the Goblin King2010-03-28T15:27:00+00:00 18 MB 
[TXT]The Same Only Different2010-03-29T12:46:00+00:00 23 MB 
[TXT]Family of Angels2010-03-30T10:05:00+00:00 22 MB 
[TXT]The Case of the Missing Mogul A Reminiscence of Dr. Jarvis Weston, M.D2010-03-31T07:24:00+00:00 17 MB 
[TXT]The Meister's Approach to Writing2010-04-01T04:43:00+00:00 23 MB 
[TXT]The Dance The Sequel to Allegiance2010-04-02T02:02:00+00:00 19 MB 
[TXT]Can You Hear the Music?2010-04-02T23:21:00+00:00 20 MB 
[TXT]Dragon and the Rose, Part 2 The Confrontation2010-04-03T20:40:00+00:00 25 MB 
[TXT]Memoirs of a Survivor of the Twentieth Century From Transylvania to the United States2010-04-04T17:59:00+00:00 22 MB 
[TXT]A Deliberate Life A Journey into the Alaskan Wilderness2010-04-05T15:18:00+00:00 17 MB 
[TXT]Instincts The Hidden Spirits That Drive You2010-04-06T12:37:00+00:00 25 MB 
[TXT]The Electronic Prophet A Novel2010-04-07T09:56:00+00:00 18 MB 
[TXT]Charlotte's Tree2010-04-08T07:15:00+00:00 25 MB 
[TXT]Going Down2010-04-09T04:34:00+00:00 24 MB 
[TXT]Keys to Becoming a Virtuous Woman2010-04-10T01:53:00+00:00 23 MB 
[TXT]The Black Messiah Murders, No. 1 A Sam Cohen Case Adventure2010-04-10T23:12:00+00:00 17 MB 
[TXT]Gravity Decoded Exploring the Structure of Space-Energy2010-04-11T20:31:00+00:00 24 MB 
[TXT]Ready the Eight2010-04-12T17:50:00+00:00 24 MB 
[TXT]The Cannae Sutra The Scots Joy of Sex!2010-04-13T15:09:00+00:00 17 MB 
[TXT]Healthy Church Dna® Transforming the Church for Effective Ministry2010-04-14T12:28:00+00:00 21 MB 
[TXT]Discover the Secret of True Love2010-04-15T09:47:00+00:00 23 MB 
[TXT]The Accidental Agent2010-04-16T07:06:00+00:00 22 MB 
[TXT]Searching for Love A Semi Comedic Autobiographical Account2010-04-17T04:25:00+00:00 18 MB 
[TXT]A Romance of Coca Or the Secret of a Villa A Novel2010-04-18T01:44:00+00:00 22 MB 
[TXT]666 A Novel2010-04-18T23:03:00+00:00 18 MB 
[TXT]D.N.A.2010-04-19T20:22:00+00:00 23 MB 
[TXT]The Food of God, Vol. # 1 Spiritual Foods for Spiritual Breakthroughs2010-04-20T17:41:00+00:00 22 MB 
[TXT]Angels, Show Me the Way Tools for Your Healing Journey2010-04-21T15:00:00+00:00 19 MB 
[TXT]Eastern Wisdom Helps Enterprise The True Story of a Successful Entrepreneur2010-04-22T12:19:00+00:00 19 MB 
[TXT]The Bridge to I Am Rapid Advance Psychotherapy2010-04-23T09:38:00+00:00 19 MB 
[TXT]Sex and Sensuality Essays On Fun Stuff2010-04-24T06:57:00+00:00 25 MB 
[TXT]Parent's Survival Guide to Maths Homewo2010-04-25T04:16:00+00:00 22 MB 
[TXT]Lippincott's Illustrated Reviews Neuroscience2010-04-26T01:35:00+00:00 22 MB 
[TXT]Gigantic Lengths and Other Vast Megastructures2010-04-26T22:54:00+00:00 21 MB 
[TXT]Great Christian Thinkers From the Early Church Through the Middle Ages2010-04-27T20:13:00+00:00 21 MB 
[TXT]Star Brands 2011 India's Most Impactful Brands2010-04-28T17:32:00+00:00 18 MB 
[TXT]Faithful Unto Death2010-04-29T14:51:00+00:00 25 MB 
[TXT]Schooling for Social Change The Rise and Impact of Human Rights Education in India2010-04-30T12:10:00+00:00 19 MB 
[TXT]A Bloomsbury Iconography 1st Edition2010-05-01T09:29:00+00:00 18 MB 
[TXT]Whitman's Queer Children America's Homosexual Epics 1st Edition2010-05-02T06:48:00+00:00 24 MB 
[TXT]USAAF Aircraft Markings and Camouflage 1941-1947 The History of USAAF Aircraft Markings, Insignia, C2010-05-03T04:07:00+00:00 19 MB 
[TXT]New Dynamics in East Asian Politics Security, Political Economy and Society2010-05-04T01:26:00+00:00 20 MB 
[TXT]Fighter Units & Pilots of the 8th Air Force September 1942 - May2010-05-04T22:45:00+00:00 17 MB 
[TXT]Fairy Dust & the Quest For the Egg2010-05-05T20:04:00+00:00 21 MB 
[TXT]Explosive Sex !2010-05-06T17:23:00+00:00 22 MB 
[TXT]Green Hornets The History of the U.S. Air Force 20th Special Operations Squadron2010-05-07T14:42:00+00:00 21 MB 
[TXT]Trips in Time 1 - A Textbook for ICSE History and Civics2010-05-08T12:01:00+00:00 20 MB 
[TXT]The Digested Read2010-05-09T09:20:00+00:00 18 MB 
[TXT]Cambridge School Grammar 12010-05-10T06:39:00+00:00 22 MB 
[TXT]Education and Sports Psychology2010-05-11T03:58:00+00:00 17 MB 
[TXT]Born to Win2010-05-12T01:17:00+00:00 22 MB 
[TXT]The Mammoth Book of Prophecies The Predictions of Nostradamus and other Prophets, Visionaries and S2010-05-12T22:36:00+00:00 18 MB 
[TXT]Introduction to SQL and PL/SQL2010-05-13T19:55:00+00:00 22 MB 
[TXT]Enduring Faith the Promise Goes Unfulfilled Part 22010-05-14T17:14:00+00:00 21 MB 
[TXT]Soil Conservation and Organic Farming2010-05-15T14:33:00+00:00 20 MB 
[TXT]Sustainable Development Administration An Analysis of Problems of Economy Environment and Equity2010-05-16T11:52:00+00:00 17 MB 
[TXT]Nursing Diagnosis - Application to Clinical Practice2010-05-17T09:11:00+00:00 22 MB 
[TXT]Firewall Architecture for the Enterprise2010-05-18T06:30:00+00:00 24 MB 
[TXT]Death In The Stocks -Imp2010-05-19T03:49:00+00:00 22 MB 
[TXT]C++ & Introduction to C#2010-05-20T01:08:00+00:00 18 MB 
[TXT]Enzyme Induction- Mutagen Activation- and Carcinogen Testing in Yeast2010-05-20T22:27:00+00:00 19 MB 
[TXT]How to Assure Quality in Plastics2010-05-21T19:46:00+00:00 23 MB 
[TXT]The Yoga Bible2010-05-22T17:05:00+00:00 22 MB 
[TXT]Thunder Over Kandahar2010-05-23T14:24:00+00:00 19 MB 
[TXT]Animal Poster Book2010-05-24T11:43:00+00:00 20 MB 
[TXT]Writing Thesis Format and Style for Physical Edu. and Sports Sc.2010-05-25T09:02:00+00:00 24 MB 
[TXT]Computer Network2010-05-26T06:21:00+00:00 18 MB 
[TXT]Basic Engineering for Medics and Biologists An ESEM Primer2010-05-27T03:40:00+00:00 19 MB 
[TXT]Whats It Like to be an Ant?2010-05-28T00:59:00+00:00 23 MB 
[TXT]Museum of Voices An Autobiographical Miscellany2010-05-28T22:18:00+00:00 20 MB 
[TXT]Effective English A Boon for Learners2010-05-29T19:37:00+00:00 18 MB 
[TXT]Constantine Versus the Bankers Military - Industrial - Church Complex, New World Order, Today&am2010-05-30T16:56:00+00:00 23 MB 
[TXT]From Partying to Praying My Story, God's Glory2010-05-31T14:15:00+00:00 25 MB 
[TXT]Dear Gang A Trek Through the Twentieth Century2010-06-01T11:34:00+00:00 20 MB 
[TXT]Straight to the Point - Photoshop CS42010-06-02T08:53:00+00:00 21 MB 
[TXT]Pepper and the New Baby2010-06-03T06:12:00+00:00 21 MB 
[TXT]Building Site2010-06-04T03:31:00+00:00 23 MB 
[TXT]The Political Economy of Terrorism2010-06-05T00:50:00+00:00 17 MB 
[TXT]Platonic Drama and its Ancient Reception2010-06-05T22:09:00+00:00 18 MB 
[TXT]Natural History of Associations A Study in the Meaning of Community2010-06-06T19:28:00+00:00 18 MB 
[TXT]Fundamentals of Numerical Weather Prediction2010-06-07T16:47:00+00:00 20 MB 
[TXT]The Economics of Evaluation in Public Programs2010-06-08T14:06:00+00:00 25 MB 
[TXT]Stories of Wisdom2010-06-09T11:25:00+00:00 24 MB 
[TXT]The Wrong Messiah2010-06-10T08:44:00+00:00 19 MB 
[TXT]Variational Problems in Differential Geometry2010-06-11T06:03:00+00:00 21 MB 
[TXT]Behold the Eyes of An Eagle2010-06-12T03:22:00+00:00 22 MB 
[TXT]Simply Fun Games Blister Books2010-06-13T00:41:00+00:00 18 MB 
[TXT]Fun at the Beach Tom and Jerry (Story Book)2010-06-13T22:00:00+00:00 23 MB 
[TXT]Satellite Meltdown2010-06-14T19:19:00+00:00 22 MB 
[TXT]My Big Book of Sticker Colouring Fisher-Price (Colouring and Activity)2010-06-15T16:38:00+00:00 20 MB 
[TXT]How to Plan Direct Mail2010-06-16T13:57:00+00:00 22 MB 
[TXT]Tom & Jerry Black Paper Colouring Paper Colouring2010-06-17T11:16:00+00:00 21 MB 
[TXT]My Big Book of Copy Colouring Bob the Builder (Colouring and Activity)2010-06-18T08:35:00+00:00 19 MB 
[TXT]My Big Book of Sticker Colouring Bob the Builder (Colouring and Activity)2010-06-19T05:54:00+00:00 23 MB 
[TXT]Sticker Copy Colouring Spongebob Squarepants (Colouring and Activity)2010-06-20T03:13:00+00:00 23 MB 
[TXT]21st Century Geography A Reference Handbook 2 Vols.2010-06-21T00:32:00+00:00 20 MB 
[TXT]It Happens only in India2010-06-21T21:51:00+00:00 17 MB 
[TXT]Farm Birds First Puzzles2010-06-22T19:10:00+00:00 24 MB 
[TXT]Mastering Maths Kindergarten2010-06-23T16:29:00+00:00 23 MB 
[TXT]Time Tables Playmats2010-06-24T13:48:00+00:00 17 MB 
[TXT]The Orchard Book of Grimm&am2010-06-25T11:07:00+00:00 22 MB 
[TXT]Sea Animals Water Magic2010-06-26T08:26:00+00:00 22 MB 
[TXT]Delhi the City of Monuments2010-06-27T05:45:00+00:00 18 MB 
[TXT]Capitalism and Climate Change Theoretical Discussion, Historical Development and Policy Responses2010-06-28T03:04:00+00:00 19 MB 
[TXT]Development in Developing Economies2010-06-29T00:23:00+00:00 21 MB 
[TXT]Copy Colouring Tom and Jerry (Colouring and Activity Die Shaped)2010-06-29T21:42:00+00:00 24 MB 
[TXT]ERC : Story of Doctor Dolittle Belly Ban2010-06-30T19:01:00+00:00 18 MB 
[TXT]The Freud Files An Inquiry into the History of Psychoanalysis2010-07-01T16:20:00+00:00 17 MB 
[TXT]First Objects Trace and Colour2010-07-02T13:39:00+00:00 25 MB 
[TXT]365 Puzzles2010-07-03T10:58:00+00:00 22 MB 
[TXT]Encyclopaedia of Physical Education, Sports and Exercise Science 4 Vols.2010-07-04T08:17:00+00:00 20 MB 
[TXT]Reconstructing Earth's Climate History Inquiry-base2010-07-05T05:36:00+00:00 21 MB 
[TXT]First Puzzles: Vegetables2010-07-06T02:55:00+00:00 19 MB 
[TXT]E.X. Ferrars A Companion to the Mystery Fiction2010-07-07T00:14:00+00:00 20 MB 
[TXT]Kangaroos My First Lessons Paper Models2010-07-07T21:33:00+00:00 21 MB 
[TXT]Socio-Economic Profile of Rural India (Series II)2010-07-08T18:52:00+00:00 19 MB 
[TXT]Biodiversity in Agriculture Domestication, Evolution, and Sustainability 1st Edition2010-07-09T16:11:00+00:00 24 MB 
[TXT]Discrete Models of Financial Markets2010-07-10T13:30:00+00:00 19 MB 
[TXT]Raman Spectroscopy and its Application in Nanostructures2010-07-11T10:49:00+00:00 20 MB 
[TXT]Scientific Methods of Training and Coaching2010-07-12T08:08:00+00:00 17 MB 
[TXT]Bihari Satsai A Commentary2010-07-13T05:27:00+00:00 24 MB 
[TXT]The Best Way to Catch a Snake2010-07-14T02:46:00+00:00 21 MB 
[TXT]Ethnobotony of the Kondh Poraja Gadaba and Bonda of the Koraput Region of Odisha India 1st Edition2010-07-15T00:05:00+00:00 22 MB 
[TXT]Luxury Retail Management How the World&a2010-07-15T21:24:00+00:00 20 MB 
[TXT]Women in Love2010-07-16T18:43:00+00:00 19 MB 
[TXT]Progress in Food Preservation2010-07-17T16:02:00+00:00 20 MB 
[TXT]New Lands within the Arctic Circle Narrative of the Discoveries of the Austrian Ship Tegetthoff in t2010-07-18T13:21:00+00:00 20 MB 
[TXT]Discovering Chemistry with Natural Bond Orbitals2010-07-19T10:40:00+00:00 17 MB 
[TXT]My Experiments with Truth (An Autobiography)2010-07-20T07:59:00+00:00 21 MB 
[TXT]Linguistic Fieldwork A Student Guide2010-07-21T05:18:00+00:00 23 MB 
[TXT]The Cambridge History of Religions in the Ancient World 2 Vols. 1st Edition2010-07-22T02:37:00+00:00 21 MB 
[TXT]Textbook of Biochemistry for Dental Students2010-07-22T23:56:00+00:00 25 MB 
[TXT]Learning English Book, 22010-07-23T21:15:00+00:00 17 MB 
[TXT]The Cambridge History of Musical Performance2010-07-24T18:34:00+00:00 22 MB 
[TXT]Jamia Geographical Studies (A Collection of Geographical Essays) 1st Edition2010-07-25T15:53:00+00:00 20 MB 
[TXT]Natural Disaster Women's Coping Strategy2010-07-26T13:12:00+00:00 19 MB 
[TXT]Hearing Voices The Histories, Causes and Meanings of Auditory Verbal Hallucinations2010-07-27T10:31:00+00:00 25 MB 
[TXT]Food for Thought [A Book of Inspiring Quotes]2010-07-28T07:50:00+00:00 25 MB 
[TXT]I Can Make You Smarter2010-07-29T05:09:00+00:00 22 MB 
[TXT]Marketing and Business Ethics2010-07-30T02:28:00+00:00 22 MB 
[TXT]Hotel Organization and Management2010-07-30T23:47:00+00:00 22 MB 
[TXT]Tales of a Midwife2010-07-31T21:06:00+00:00 18 MB 
[TXT]The Church of England and Episcopacy2010-08-01T18:25:00+00:00 24 MB 
[TXT]How to Borrow from Banking & Financial Institutions2010-08-02T15:44:00+00:00 18 MB 
[TXT]Instructional Technology2010-08-03T13:03:00+00:00 19 MB 
[TXT]Fauna Boreali-Americana, Vols. 2 The Birds, Containing Descriptions of the Objects of Natural Histor2010-08-04T10:22:00+00:00 17 MB 
[TXT]Roothi Rani and Prema2010-08-05T07:41:00+00:00 18 MB 
[TXT]Genetics and Heredity2010-08-06T05:00:00+00:00 20 MB 
[TXT]Fisheries2010-08-07T02:19:00+00:00 25 MB 
[TXT]Corporal Punishment of Children2010-08-07T23:38:00+00:00 22 MB 
[TXT]Education, National Integration and Development2010-08-08T20:57:00+00:00 19 MB 
[TXT]Food Microbiology2010-08-09T18:16:00+00:00 23 MB 
[TXT]The New Business of Business Sharing Responsibility for a Positive Global Future2010-08-10T15:35:00+00:00 25 MB 
[TXT]Trips in Time 2 Teachers Manual A Textbook for ICSE History and Civics2010-08-11T12:54:00+00:00 24 MB 
[TXT]A Case-Based Approach to PET/CT in Oncology2010-08-12T10:13:00+00:00 20 MB 
[TXT]The Golden Bough2010-08-13T07:32:00+00:00 23 MB 
[TXT]Polymers for Electricity and Electronics Materials, Properties, and Applications2010-08-14T04:51:00+00:00 23 MB 
[TXT]FlexRay and its Applications Real Time Multiplexed Network2010-08-15T02:10:00+00:00 19 MB 
[TXT]An Account of the Basalts of Saxony With Observations on the Origin of Basalt in General2010-08-15T23:29:00+00:00 20 MB 
[TXT]Ways of Social Change Making Sense of Modern Times2010-08-16T20:48:00+00:00 23 MB 
[TXT]Greek Art and the Orient2010-08-17T18:07:00+00:00 22 MB 
[TXT]Maqta : Ghalib on Ghalib [100 Signature Couplets of Mirza Asadullah Khan Ghalib] 1st Edition2010-08-18T15:26:00+00:00 22 MB 
[TXT]A Small Circus2010-08-19T12:45:00+00:00 22 MB 
[TXT]Great Ground Meat Recipes2010-08-20T10:04:00+00:00 24 MB 
[TXT]Freedom, Vol. 2 A Documentary History of Emancipation, 186118672010-08-21T07:23:00+00:00 20 MB 
[TXT]Progress in Neurotherapeutics and Neuropsychopharmacology, Vol. 1, 20062010-08-22T04:42:00+00:00 21 MB 
[TXT]Travels in Crete2010-08-23T02:01:00+00:00 18 MB 
[TXT]Kant Natural Science2010-08-23T23:20:00+00:00 22 MB 
[TXT]The Cambridge Companion to Modern Indian Culture2010-08-24T20:39:00+00:00 19 MB 
[TXT]Numerical Methods in Finance with C++2010-08-25T17:58:00+00:00 19 MB 
[TXT]Quantum Information, Computation and Communication 1st Edition2010-08-26T15:17:00+00:00 17 MB 
[TXT]Milton and the Art of Rhetoric2010-08-27T12:36:00+00:00 20 MB 
[TXT]Genomics and Bioinformatics An Introduction to Programming Tools for Life Scientists2010-08-28T09:55:00+00:00 19 MB 
[TXT]Performance in the Texts of Mallarm E The Passage from Art to Ritual2010-08-29T07:14:00+00:00 22 MB 
[TXT]Beastly Things2010-08-30T04:33:00+00:00 21 MB 
[TXT]The Future of Employment Relations2010-08-31T01:52:00+00:00 19 MB 
[TXT]Wife Rape Understanding the Response of Survivors and Service Providers2010-08-31T23:11:00+00:00 20 MB 
[TXT]The Principal's Guide to Raising Math Achievement2010-09-01T20:30:00+00:00 25 MB 
[TXT]Teachings of Rumi2010-09-02T17:49:00+00:00 18 MB 
[TXT]E-Resources for Teaching and Learning2010-09-03T15:08:00+00:00 22 MB 
[TXT]Management and Policy Issues2010-09-04T12:27:00+00:00 21 MB 
[TXT]Psychopathological Disorders Biopsychosocial Analysis2010-09-05T09:46:00+00:00 23 MB 
[TXT]Solid and Hazardous Waste Management2010-09-06T07:05:00+00:00 17 MB 
[TXT]Finding Peace of Mind2010-09-07T04:24:00+00:00 24 MB 
[TXT]Understanding Plant Hormones2010-09-08T01:43:00+00:00 17 MB 
[TXT]Counseling and Psychotherapy Theories in Context and Practice Study Guide 2nd Edition2010-09-08T23:02:00+00:00 17 MB 
[TXT]People's Reactions to Technology In Factories, Offices, and Aerospa2010-09-09T20:21:00+00:00 21 MB 
[TXT]Social Research in Communication and Law2010-09-10T17:40:00+00:00 20 MB 
[TXT]Information Campaigns Balancing Social Values and Social Change2010-09-11T14:59:00+00:00 25 MB 
[TXT]Qualitative Nursing Research A Contemporary Dialogue2010-09-12T12:18:00+00:00 20 MB 
[TXT]Corporate Political Agency The Construction of Competition in Public Affairs2010-09-13T09:37:00+00:00 25 MB 
[TXT]Mythic Monsters Revisited2010-09-14T06:56:00+00:00 18 MB 
[TXT]The Responsibility to Protect Rhetoric, Reality and the Future of Humanitarian Intervention2010-09-15T04:15:00+00:00 25 MB 
[TXT]Privitera, Statistics for the Behavioral Sciences + Study Guide + WebAssign [BUNDLE]2010-09-16T01:34:00+00:00 18 MB 
[TXT]Typographia, or The Printers Instructor Including an Account of the Origin of Printing, with Biogr2010-09-16T22:53:00+00:00 20 MB 
[TXT]Understanding Social Work Research 2nd Edition2010-09-17T20:12:00+00:00 18 MB 
[TXT]Larger Than Life2010-09-18T17:31:00+00:00 22 MB 
[TXT]English Ks1 6-72010-09-19T14:50:00+00:00 22 MB 
[TXT]No One Left to Tell2010-09-20T12:09:00+00:00 18 MB 
[TXT]Social Research Survey and Statistics2010-09-21T09:28:00+00:00 18 MB 
[TXT]Nuclear Accident2010-09-22T06:47:00+00:00 18 MB 
[TXT]Electrical Science2010-09-23T04:06:00+00:00 21 MB 
[TXT]Tribal Women in India2010-09-24T01:25:00+00:00 22 MB 
[TXT]DIRECT Tax Laws Online [1886-2012] (With Weekly Internet Updation)2010-09-24T22:44:00+00:00 18 MB 
[TXT]Johnson, Meeting the Ethical Challenges of Leadership, 4 Edition + SAGE, SAGE Brief Guide to Busine2010-09-25T20:03:00+00:00 17 MB 
[TXT]Fuzzy Nation2010-09-26T17:22:00+00:00 24 MB 
[TXT]Dictionary of Science (English-English-Hindi)2010-09-27T14:41:00+00:00 22 MB 
[TXT]Formulae Mathematics, Vol. I2010-09-28T12:00:00+00:00 19 MB 
[TXT]Encyclopaedia of Home Science2010-09-29T09:19:00+00:00 24 MB 
[TXT]Text Book of Chemical Kinetics2010-09-30T06:38:00+00:00 19 MB 
[TXT]West African Challenge to Empire Culture and History in the Volta-Bani Anticolonial War2010-10-01T03:57:00+00:00 22 MB 
[TXT]Hour of the Wolf [Carambole]2010-10-02T01:16:00+00:00 17 MB 
[TXT]Nigerian Video Films2010-10-02T22:35:00+00:00 21 MB 
[TXT]Spindrift Stories from the U.S. Sea Services2010-10-03T19:54:00+00:00 22 MB 
[TXT]All Gong and No Dinner 1001 Homely Phrases and Curious Domestic Sayings2010-10-04T17:13:00+00:00 24 MB 
[TXT]Twelve Years with Hitler A History of 1.Kompanie Leibstandarte SS Adolf Hitler, 1933-452010-10-05T14:32:00+00:00 24 MB 
[TXT]Wisdom Roads Conversations with Remarkable Meditation2010-10-06T11:51:00+00:00 18 MB 
[TXT]Bachem Ba 349 Natter2010-10-07T09:10:00+00:00 18 MB 
[TXT]Life Our Century in Pictures for Young People2010-10-08T06:29:00+00:00 25 MB 
[TXT]The Early Middle Ages From Late Antiquity to A.D. 10002010-10-09T03:48:00+00:00 23 MB 
[TXT]Find a Cow NOW!2010-10-10T01:07:00+00:00 21 MB 
[TXT]Memoirs of a Political Officers Wife in Tibet, Sikkim, and Bhutan2010-10-10T22:26:00+00:00 19 MB 
[TXT]The Wake of Iconoclasm Painting the Church in the Dutch Republic2010-10-11T19:45:00+00:00 19 MB 
[TXT]Graven Images The Averillan Chronicles, Book 22010-10-12T17:04:00+00:00 19 MB 
[TXT]Music Therapy in Principle and Practice 2nd Edition2010-10-13T14:23:00+00:00 17 MB 
[TXT]German Heavy Reconnaissance Vehicles2010-10-14T11:42:00+00:00 22 MB 
[TXT]Panzer IV2010-10-15T09:01:00+00:00 18 MB 
[TXT]Jungle Friends2010-10-16T06:20:00+00:00 20 MB 
[TXT]Jigsaw Farm and Toy2010-10-17T03:39:00+00:00 22 MB 
[TXT]The Shape of Cars to Come2010-10-18T00:58:00+00:00 17 MB 
[TXT]Germany Military Trailers and Towed Equipment in WWII2010-10-18T22:17:00+00:00 22 MB 
[TXT]CompTIA Security+ ETestPrep (SY0-301)2010-10-19T19:36:00+00:00 22 MB 
[TXT]This Dark Earth2010-10-20T16:55:00+00:00 25 MB 
[TXT]Agricultural and Rural Economics Agriculture and Rural Development 1st Edition2010-10-21T14:14:00+00:00 17 MB 
[TXT]2000 Quotes from Hitlers 1000-Year Reich2010-10-22T11:33:00+00:00 18 MB 
[TXT]Wicked Nights2010-10-23T08:52:00+00:00 17 MB 
[TXT]The Faerie Guidance Oracle 1st Edition2010-10-24T06:11:00+00:00 23 MB 
[TXT]The Boaters Medical Companion2010-10-25T03:30:00+00:00 22 MB 
[TXT]The Law of Marine Collision2010-10-26T00:49:00+00:00 19 MB 
[TXT]Women's Health2010-10-26T22:08:00+00:00 17 MB 
[TXT]Black Heart2010-10-27T19:27:00+00:00 23 MB 
[TXT]Uppity My Untold Story About the Games People Play2010-10-28T16:46:00+00:00 19 MB 
[TXT]The Right Instrument for Your Child The Key to Unlocking Musical Potential2010-10-29T14:05:00+00:00 25 MB 
[TXT]The Parisian&2010-10-30T11:24:00+00:00 24 MB 
[TXT]Cartularium Saxonicum, AD 840947, Vol. 2 A Collection of Charters Relating to Anglo-Saxon History2010-10-31T08:43:00+00:00 24 MB 
[TXT]China 50 Years Inside the People&2010-11-01T06:02:00+00:00 24 MB 
[TXT]United States Navy Patches Series, Vol. 3 Fighter, Fighter-Attack, Recon. Squadrons2010-11-02T03:21:00+00:00 25 MB 
[TXT]Tibetan Voices A Traditional Memoir2010-11-03T00:40:00+00:00 25 MB 
[TXT]Perfect Country Rooms2010-11-03T21:59:00+00:00 25 MB 
[TXT]Real Chocolate2010-11-04T19:18:00+00:00 18 MB 
[TXT]Duncan, Family Life Education, 2 Edition + Ballard, Family Life Education With Diverse Populations2010-11-05T16:37:00+00:00 20 MB 
[TXT]The Autism Puzzle Connecting the Dots Between Environmental Toxins and Rising Autism Rates2010-11-06T13:56:00+00:00 23 MB 
[TXT]Morse Homology2010-11-07T11:15:00+00:00 20 MB 
[TXT]Economies of Relation Money and Personalism in the Lusophone World2010-11-08T08:34:00+00:00 23 MB 
[TXT]The Israel Museum, Jerusalem2010-11-09T05:53:00+00:00 25 MB 
[TXT]Death in Sardinia2010-11-10T03:12:00+00:00 25 MB 
[TXT]Mickey Mouse Issue XVI2010-11-11T00:31:00+00:00 23 MB 
[TXT]Submerged2010-11-11T21:50:00+00:00 25 MB 
[TXT]Trading Fundamentals2010-11-12T19:09:00+00:00 19 MB 
[TXT]Cool Weather Fashions2010-11-13T16:28:00+00:00 20 MB 
[TXT]Style to Go Kitchens Illustrated Edition2010-11-14T13:47:00+00:00 19 MB 
[TXT]Garden Ornaments 30 Beautiful Projects for Decorating Your Garden Illustrated Edition2010-11-15T11:06:00+00:00 19 MB 
[TXT]Strategies For Anger Management2010-11-16T08:25:00+00:00 19 MB 
[TXT]Rethinking International Cooperation In Criminal Matters In The Eu Moving beyond Actors, Bringing L2010-11-17T05:44:00+00:00 18 MB 
[TXT]Forever Ours Real Stories of Immortality and Living from a Forensic Pathologist 4 CDs Unabridged Edi2010-11-18T03:03:00+00:00 20 MB 
[TXT]White on White Creating Elegant Rooms with Classic Whites2010-11-19T00:22:00+00:00 20 MB 
[TXT]Quick and Easy Dresses to Sew2010-11-19T21:41:00+00:00 18 MB 
[TXT]The Brain and the Meaning of Life2010-11-20T19:00:00+00:00 23 MB 
[TXT]The Essential Christian Classics Collection2010-11-21T16:19:00+00:00 18 MB 
[TXT]American Gladius A Study of the M-9 Multi-Purpose Bayonet System Mack2010-11-22T13:38:00+00:00 25 MB 
[TXT]Robot Battle Paper Action Figures2010-11-23T10:57:00+00:00 17 MB 
[TXT]The Secret Clocks Time Senses of Living Things2010-11-24T08:16:00+00:00 18 MB 
[TXT]Russia and the West from Alexander to Putin Honor in International Relations2010-11-25T05:35:00+00:00 19 MB 
[TXT]The Weather Observer's Hand2010-11-26T02:54:00+00:00 21 MB 
[TXT]Vaidika Marriage Ceremonial = Vaidika Vivaha Samskara Vidhi2010-11-27T00:13:00+00:00 22 MB 
[TXT]Journal of an Embassy from the Governor General of India to the Court of Ava, in the Year 18272010-11-27T21:32:00+00:00 23 MB 
[TXT]Translational Neuroscience Applications in Psychiatry, Neurology, and Neurodevelopmental Disorders2010-11-28T18:51:00+00:00 19 MB 
[TXT]Like Dandelion Dust & This Side of H2010-11-29T16:10:00+00:00 25 MB 
[TXT]Pausanias's Description of Greece, Vol. 3 Commentary on Books IIV2010-11-30T13:29:00+00:00 17 MB 
[TXT]Pausanias's Description of Greece, Vol. 1 Translation2010-12-01T10:48:00+00:00 23 MB 
[TXT]Teutonic Mythology2010-12-02T08:07:00+00:00 21 MB 
[TXT]Iqbal in Politics2010-12-03T05:26:00+00:00 23 MB 
[TXT]Problem Solving in Organizations A Methodological Handbook for Business and Management Students 2nd2010-12-04T02:45:00+00:00 19 MB 
[TXT]Core Topics in Vascular Anaesthesia2010-12-05T00:04:00+00:00 24 MB 
[TXT]An Introduction to Animal Behaviour 6th Edition2010-12-05T21:23:00+00:00 21 MB 
[TXT]Yinyang The Way of Heaven and Earth in Chinese Thought and Culture2010-12-06T18:42:00+00:00 17 MB 
[TXT]Judging Social Rights2010-12-07T16:01:00+00:00 23 MB 
[TXT]Educative Tales of Bible2010-12-08T13:20:00+00:00 24 MB 
[TXT]Old Errors and New Labels2010-12-09T10:39:00+00:00 18 MB 
[TXT]The Postcolonial Low Countries Literature, Colonialism, and Multiculturalism2010-12-10T07:58:00+00:00 18 MB 
[TXT]Blessed Assurance Inspiration from the Beloved Hymn2010-12-11T05:17:00+00:00 19 MB 
[TXT]Sinful Chocolate2010-12-12T02:36:00+00:00 21 MB 
[TXT]Love & Eroticism2010-12-12T23:55:00+00:00 23 MB 
[TXT]Herbs and Spices2010-12-13T21:14:00+00:00 20 MB 
[TXT]The Research Funding Toolkit How to Plan and Write Successful Grant Applications2010-12-14T18:33:00+00:00 23 MB 
[TXT]Berlin Skyline2010-12-15T15:52:00+00:00 21 MB 
[TXT]Redrawing Anthropology Materials, Movements, Lines2010-12-16T13:11:00+00:00 17 MB 
[TXT]Correlations Between the Physical and Social Sciences2010-12-17T10:30:00+00:00 25 MB 
[TXT]Captured Fire Seasonal and Sanctoral Cycle, Year Two2010-12-18T07:49:00+00:00 18 MB 
[TXT]Joyce, T. S. Eliot, Auden, Beckett Great Shakespeareans2010-12-19T05:08:00+00:00 18 MB 
[TXT]Molecular Approaches For Plant Fungal Disease Management 1st Edition2010-12-20T02:27:00+00:00 23 MB 
[TXT]The Red Sea from Byzantium to the Caliphate AD 500-10002010-12-20T23:46:00+00:00 21 MB 
[TXT]Family Living Classics Simply Delicious Chocolate2010-12-21T21:05:00+00:00 22 MB 
[TXT]Cultural Agility Building a Pipeline of Successful Global Professionals2010-12-22T18:24:00+00:00 18 MB 
[TXT]Snow White Activity Book Green Edition2010-12-23T15:43:00+00:00 19 MB 
[TXT]The House Gun A Novel2010-12-24T13:02:00+00:00 24 MB 
[TXT]Church Signs A Humorous Look at the Faithful Side of Life2010-12-25T10:21:00+00:00 18 MB 
[TXT]St Francis of Assisi2010-12-26T07:40:00+00:00 17 MB 
[TXT]The Greatest Marian Prayers Their History, Meaning and Usage2010-12-27T04:59:00+00:00 22 MB 
[TXT]Probability with Statistical Applications 2nd Edition2010-12-28T02:18:00+00:00 19 MB 
[TXT]Felting Fever2010-12-28T23:37:00+00:00 19 MB 
[TXT]City of Light2010-12-29T20:56:00+00:00 19 MB 
[TXT]Higher Order Basis Based Integral Equation Solver2010-12-30T18:15:00+00:00 21 MB 
[TXT]Handbook of Neural Activity Measurement2010-12-31T15:34:00+00:00 24 MB 
[TXT]Current Developments in Algebraic Geometry 1st Edition2011-01-01T12:53:00+00:00 18 MB 
[TXT]Classical Algebraic Geometry A Modern View2011-01-02T10:12:00+00:00 25 MB 
[TXT]Modern Technology of Frozen Food Products2011-01-03T07:31:00+00:00 21 MB 
[TXT]Zutot 20042011-01-04T04:50:00+00:00 22 MB 
[TXT]Perspectives on West Asia The Evolving Geopolitical Discourses2011-01-05T02:09:00+00:00 17 MB 
[TXT]Education for Mental Health Rethinking Issues in Guidance and Counselling2011-01-05T23:28:00+00:00 25 MB 
[TXT]Plant Nursery Management How to Start and Operate a Plant Nursery2011-01-06T20:47:00+00:00 20 MB 
[TXT]Dynamics of India's Export Performances2011-01-07T18:06:00+00:00 21 MB 
[TXT]Dr. V Nageswara Rao The Indian Evidence Act A Critical Commentary Covering Emering Issues and Intern2011-01-08T15:25:00+00:00 25 MB 
[TXT]Heal's2011-01-09T12:44:00+00:00 18 MB 
[TXT]Heirloom Afghans2011-01-10T10:03:00+00:00 22 MB 
[TXT]Russia's Energy Policies National, Interregional and Global Levels2011-01-11T07:22:00+00:00 24 MB 
[TXT]Savages2011-01-12T04:41:00+00:00 22 MB 
[TXT]Triquarterly 103 An International Journal of Writing, Art, and Cultural Inquiry2011-01-13T02:00:00+00:00 18 MB 
[TXT]A Social History of Iranian Cinema, Vol. 1 The Artisanal Era, 1897-19412011-01-13T23:19:00+00:00 21 MB 
[TXT]Lullaby Layettes2011-01-14T20:38:00+00:00 21 MB 
[TXT]The Very Easy Guide to Using Your Sewing Machine2011-01-15T17:57:00+00:00 18 MB 
[TXT]Ghost Jokes for Kids 1st Edition2011-01-16T15:16:00+00:00 20 MB 
[TXT]Blindness A Family Matter2011-01-17T12:35:00+00:00 22 MB 
[TXT]Over Time My Life as a Sportswriter2011-01-18T09:54:00+00:00 22 MB 
[TXT]The Seductive Image Cinema and the Christian Faith2011-01-19T07:13:00+00:00 22 MB 
[TXT]Announcing the Reign of God2011-01-20T04:32:00+00:00 19 MB 
[TXT]Is the Bible Sexist?2011-01-21T01:51:00+00:00 22 MB 
[TXT]Living or Nonliving?2011-01-21T23:10:00+00:00 25 MB 
[TXT]Scripture in Context Essays on the Comparative Method2011-01-22T20:29:00+00:00 20 MB 
[TXT]The Truth About William Shakespeare Fact, Fiction, and Modern Biographies2011-01-23T17:48:00+00:00 17 MB 
[TXT]Carnivore Ecology and Conservation A Handbook of Techniques2011-01-24T15:07:00+00:00 22 MB 
[TXT]Kiss That Frog! 12 Great Ways to Turn Negatives into Positives in Your Life and Work2011-01-25T12:26:00+00:00 19 MB 
[TXT]The Apocalypse of John2011-01-26T09:45:00+00:00 20 MB 
[TXT]Oscar and the Bird A Book About Electricity2011-01-27T07:04:00+00:00 21 MB 
[TXT]The World Is a Prison2011-01-28T04:23:00+00:00 21 MB 
[TXT]Discrete Mathematics Through Applications, Vol. 12011-01-29T01:42:00+00:00 20 MB 
[TXT]Journey of Love Reader2011-01-29T23:01:00+00:00 19 MB 
[TXT]The Sun Gods Children The History, Culture, and Legends of the Blackfeet Indians2011-01-30T20:20:00+00:00 23 MB 
[TXT]Do You Know2011-01-31T17:39:00+00:00 18 MB 
[TXT]Emerging Risks A Strategic Management Guide2011-02-01T14:58:00+00:00 18 MB 
[TXT]Corporate Governance After the Financial Crisis2011-02-02T12:17:00+00:00 18 MB 
[TXT]Information Processing in Medical Imaging 16th International Conference, IPMI99, Visegrad, Hungary,2011-02-03T09:36:00+00:00 22 MB 
[TXT]The Case of the School Ghost2011-02-04T06:55:00+00:00 23 MB 
[TXT]An Apology for Apologetics A Study in the Logic of Interreligious Dialogue2011-02-05T04:14:00+00:00 17 MB 
[TXT]Puppet on A Chain2011-02-06T01:33:00+00:00 19 MB 
[TXT]What's Good for Business Business and American Politics since World War II2011-02-06T22:52:00+00:00 21 MB 
[TXT]Enlightened Aid U.S. Development as Foreign Policy in Ethiopia2011-02-07T20:11:00+00:00 21 MB 
[TXT]Urban Social Capital Civil Society and City Life2011-02-08T17:30:00+00:00 23 MB 
[TXT]Telemorphosis2011-02-09T14:49:00+00:00 21 MB 
[TXT]Ladder to Excellence in Homeopathic Education Education Technology, Education in Medicine Adaotation2011-02-10T12:08:00+00:00 18 MB 
[TXT]Apocalypse of the Dead 13 CDs2011-02-11T09:27:00+00:00 23 MB 
[TXT]Revisiting Literature Criticism and Aesthetics in India2011-02-12T06:46:00+00:00 18 MB 
[TXT]Saltwater Fish2011-02-13T04:05:00+00:00 23 MB 
[TXT]Me, the Queen and Christopher2011-02-14T01:24:00+00:00 19 MB 
[TXT]Founders of Old Testament Criticism Biographical, Descriptive, and Critical Studies2011-02-14T22:43:00+00:00 23 MB 
[TXT]Then They Came for Me 118 Days in Iran's Most Notorious Prison2011-02-15T20:02:00+00:00 18 MB 
[TXT]Dream Catchers2011-02-16T17:21:00+00:00 20 MB 
[TXT]I Am Food The Mass in Planetary Perspective2011-02-17T14:40:00+00:00 18 MB 
[TXT]God in Three Persons2011-02-18T11:59:00+00:00 18 MB 
[TXT]Terrorism and Public Health A Balanced Approach to Strengthening Systems and Protecting People2011-02-19T09:18:00+00:00 25 MB 
[TXT]I Dont Want To go To Bed2011-02-20T06:37:00+00:00 23 MB 
[TXT]Leadocracy Hiring More Great Leaders (Like You) into Public Service2011-02-21T03:56:00+00:00 20 MB 
[TXT]Kapasi Sarcoma A Model of Oncogenesis2011-02-22T01:15:00+00:00 17 MB 
[TXT]Jesus - Jeshua Studies in the Gospels2011-02-22T22:34:00+00:00 18 MB 
[TXT]Notes, Critical and Practical, on the Book of Numbers Designed as a General Help to Biblical Readin2011-02-23T19:53:00+00:00 21 MB 
[TXT]Portrait of Youth Ministry2011-02-24T17:12:00+00:00 25 MB 
[TXT]Storm Clouds Over Chantel2011-02-25T14:31:00+00:00 20 MB 
[TXT]Continental Britons German-Jewish Refugees from Nazi Germany Revised Edition2011-02-26T11:50:00+00:00 18 MB 
[TXT]My Favourite Colouring Book-12011-02-27T09:09:00+00:00 18 MB 
[TXT]Father Knows Best [Boxed Set]2011-02-28T06:28:00+00:00 23 MB 
[TXT]Colour Fun (Green)2011-03-01T03:47:00+00:00 17 MB 
[TXT]The UK Competition Act A New Era for UK Competition Law2011-03-02T01:06:00+00:00 24 MB 
[TXT]Jesus as God The New Testament Use of Theos in Reference to Jesus2011-03-02T22:25:00+00:00 22 MB 
[TXT]Cold Fusion Aspects of the German Cultural Presence in Russia2011-03-03T19:44:00+00:00 18 MB 
[TXT]Computer Today-72011-03-04T17:03:00+00:00 18 MB 
[TXT]Amazing Love True Stories of the Power of Forgiveness2011-03-05T14:22:00+00:00 22 MB 
[TXT]Have Fun with Division2011-03-06T11:41:00+00:00 19 MB 
[TXT]Nature In German History2011-03-07T09:00:00+00:00 20 MB 
[TXT]An Introduction to Human Rights and the Common Law2011-03-08T06:19:00+00:00 22 MB 
[TXT]Evaluation and Legal Theory2011-03-09T03:38:00+00:00 17 MB 
[TXT]Dark Homecoming2011-03-10T00:57:00+00:00 21 MB 
[TXT]Genesis and Semitic Tradition2011-03-10T22:16:00+00:00 23 MB 
[TXT]Am I Sleeping with the Enemy? Males and Females in the Image of God2011-03-11T19:35:00+00:00 18 MB 
[TXT]Go Positive Leading to Engage PW2011-03-12T16:54:00+00:00 19 MB 
[TXT]The Tortious Liability of Statutory Bodies A Comparative and Economic Analysis of Five Cases2011-03-13T14:13:00+00:00 25 MB 
[TXT]Cambridge Yearbook of European Legal Studies Vol 4, 20012011-03-14T11:32:00+00:00 21 MB 
[TXT]Fit To Serve Becoming What You Were Created To Be2011-03-15T08:51:00+00:00 21 MB 
[TXT]Cambridge Yearbook of European Legal Studies, Vol. 14, 2011-20122011-03-16T06:10:00+00:00 21 MB 
[TXT]Age as an Equality Issue Legal and Policy Perspectives2011-03-17T03:29:00+00:00 17 MB 
[TXT]Summer Sun Risin2011-03-18T00:48:00+00:00 18 MB 
[TXT]Surgical Anatomy of the Ocular Adnexa A Clinical Approach2011-03-18T22:07:00+00:00 19 MB 
[TXT]Unimaginable Atrocities Justice, Politics, and Rights at the War Crimes Tribunals2011-03-19T19:26:00+00:00 19 MB 
[TXT]Building Arguments2011-03-20T16:45:00+00:00 20 MB 
[TXT]Collected Resonance Shelly Bahl, Sarindar Dhaliwal,Farheen HaQ2011-03-21T14:04:00+00:00 24 MB 
[TXT]Governance of Hospitals2011-03-22T11:23:00+00:00 19 MB 
[TXT]Emerging Areas in Hospital Services2011-03-23T08:42:00+00:00 18 MB 
[TXT]Hospitals in Community Health Care2011-03-24T06:01:00+00:00 17 MB 
[TXT]Information Technology in Developing Human Resources2011-03-25T03:20:00+00:00 18 MB 
[TXT]Yearn2011-03-26T00:39:00+00:00 25 MB 
[TXT]Guidelines for Nurse Practitioners in Gynecologic Settings2011-03-26T21:58:00+00:00 23 MB 
[TXT]Where There Is Evil New Edition2011-03-27T19:17:00+00:00 18 MB 
[TXT]Organisation Theory and Designs Contemporary Concepts and Emerging Trends2011-03-28T16:36:00+00:00 24 MB 
[TXT]The Hawks of London2011-03-29T13:55:00+00:00 20 MB 
[TXT]Valley of Ashes2011-03-30T11:14:00+00:00 17 MB 
[TXT]ICT Applications in Agribusiness and Extension Education2011-03-31T08:33:00+00:00 17 MB 
[TXT]Women in Society 1st Edition2011-04-01T05:52:00+00:00 23 MB 
[TXT]Income Tax Guidelines and Mini Ready Reckoner 1999-2000, 2000-2001 Alongwith Tax Planning Wealth an2011-04-02T03:11:00+00:00 18 MB 
[TXT]Compendium of Government of India Notifications, Policy Circulars and Public Notices on input outpu2011-04-03T00:30:00+00:00 17 MB 
[TXT]Participative Management Experience from Former Yugoslavia West Germany and India 1st Edition2011-04-03T21:49:00+00:00 21 MB 
[TXT]The Creed of Buddha Reprint2011-04-04T19:08:00+00:00 25 MB 
[TXT]Development of Mysticism in Kashmir 1st Cosmo Print2011-04-05T16:27:00+00:00 21 MB 
[TXT]A Grammar of the Khassi Language Reprint London 1891 Edition2011-04-06T13:46:00+00:00 24 MB 
[TXT]The did you Know that the World Ballot Comes From Little Balls and Other Fascinating Facts about the2011-04-07T11:05:00+00:00 17 MB 
[TXT]Biolinguistics Exploring the Biology of Language2011-04-08T08:24:00+00:00 22 MB 
[TXT]UK Public Law and European Law The Dynamics of Legal Integration2011-04-09T05:43:00+00:00 20 MB 
[TXT]After National Democracy Rights, Law and Power in America and the New Europe2011-04-10T03:02:00+00:00 23 MB 
[TXT]In the Company of Witches Illustrated Edition2011-04-11T00:21:00+00:00 25 MB 
[TXT]Scourge of the Betrayer2011-04-11T21:40:00+00:00 24 MB 
[TXT]Advancing Education with Information Communication Technologies Facilitating New Trends2011-04-12T18:59:00+00:00 23 MB 
[TXT]Europe and Extraterritorial Asylum2011-04-13T16:18:00+00:00 18 MB 
[TXT]Illustrated History of Southern Wagons, Vol. 3 SECR2011-04-14T13:37:00+00:00 18 MB 
[TXT]Skyscrapers of the Midwest2011-04-15T10:56:00+00:00 17 MB 
[TXT]Technological Advancements and Applications in Mobile Ad-Hoc Networks Research Trends2011-04-16T08:15:00+00:00 19 MB 
[TXT]Collins Cobuild Pocket English-English-Telugu Dictionary Illustrated Edition2011-04-17T05:34:00+00:00 19 MB 
[TXT]Redemption Song Muhammad Ali and the Spirit of the Sixties2011-04-18T02:53:00+00:00 23 MB 
[TXT]Collection and Recollections Economic Paper and their Provenance2011-04-19T00:12:00+00:00 22 MB 
[TXT]Social Movements in Advanced Capitalism The Political Economy and Cultural Construction of Social Ac2011-04-19T21:31:00+00:00 19 MB 
[TXT]Planning for Tourism 1st Edition2011-04-20T18:50:00+00:00 22 MB 
[TXT]The Origins of Islamic Law The Quran, the Muwatta and Madinan Amal 1st Indian Reprint2011-04-21T16:09:00+00:00 23 MB 
[TXT]Quest in Reality2011-04-22T13:28:00+00:00 20 MB 
[TXT]Sports Sociology2011-04-23T10:47:00+00:00 17 MB 
[TXT]Lawyer Geisha Pink2011-04-24T08:06:00+00:00 19 MB 
[TXT]The Magician King A Novel Illustrated Edition2011-04-25T05:25:00+00:00 24 MB 
[TXT]Cultural Adaptations Tools for Evidence-Based Practice With Diverse Populations2011-04-26T02:44:00+00:00 19 MB 
[TXT]Cropping Systems for Sustainble Farming 1st Edition2011-04-27T00:03:00+00:00 25 MB 
[TXT]Ass et Recovery Handbook A Guide for Practitioners2011-04-27T21:22:00+00:00 20 MB 
[TXT]Helicopter Crew Chief2011-04-28T18:41:00+00:00 18 MB 
[TXT]The Vampire Fighters2011-04-29T16:00:00+00:00 25 MB 
[TXT]Downhome Gospel African American Spiritual Activism in Wiregrass Country2011-04-30T13:19:00+00:00 22 MB 
[TXT]Teasing Tongue Twisters2011-05-01T10:38:00+00:00 24 MB 
[TXT]Public Administration New Challenges2011-05-02T07:57:00+00:00 19 MB 
[TXT]Wheel of History 5th Edition2011-05-03T05:16:00+00:00 21 MB 
[TXT]Educational Philosophy in Modern India 1st Edition2011-05-04T02:35:00+00:00 17 MB 
[TXT]Biomechanics and Kinesiology of Human Motion2011-05-04T23:54:00+00:00 24 MB 
[TXT]Educational Psychology Professional Applications 1st Edition2011-05-05T21:13:00+00:00 18 MB 
[TXT]The Compact History of the Catholic Church 6th Print2011-05-06T18:32:00+00:00 22 MB 
[TXT]Ayurveda Chikitsa 2nd Edition2011-05-07T15:51:00+00:00 17 MB 
[TXT]The Meeting Point Based on Mahamati Prannath's Tartam Vani2011-05-08T13:10:00+00:00 24 MB 
[TXT]Humanity's Dark Side Evil, Destructive Experience, and2011-05-09T10:29:00+00:00 22 MB 
[TXT]After the Crash Psychological Assessment and Treatment of Survivors of Motor Vehicle Accidents 2nd E2011-05-10T07:48:00+00:00 24 MB 
[TXT]Healing From Within The Use of Hypnosis in Women's Health Care2011-05-11T05:07:00+00:00 23 MB 
[TXT]The History of the Future A Commentary on Revelation and Matthew 242011-05-12T02:26:00+00:00 18 MB 
[TXT]Guess Where?2011-05-12T23:45:00+00:00 21 MB 
[TXT]Latino History Day by Day A Reference Guide to Events2011-05-13T21:04:00+00:00 19 MB 
[TXT]Story of a Cockroach2011-05-14T18:23:00+00:00 21 MB 
[TXT]Computer Engineering Concepts, Methodologies, Tools and Applications 4 Vols.2011-05-15T15:42:00+00:00 19 MB 
[TXT]The Shamanic Odyssey Homer, Tolkien, and the Visionary Experience2011-05-16T13:01:00+00:00 17 MB 
[TXT]Management Information Systems for Enterprise Applications Business Issues, Research and Solutions2011-05-17T10:20:00+00:00 23 MB 
[TXT]Cerebrospinal Fluid Collections2011-05-18T07:39:00+00:00 18 MB 
[TXT]Introducing Islam A Simple Introduction to Islam Reprint2011-05-19T04:58:00+00:00 18 MB 
[TXT]The Spiritual Wisdom of Ancient Bharat 1st Edition2011-05-20T02:17:00+00:00 23 MB 
[TXT]Nepal Government and Politics2011-05-20T23:36:00+00:00 24 MB 
[TXT]Shikhar Salutations to the Himalaya 1st Edition2011-05-21T20:55:00+00:00 19 MB 
[TXT]Smoke in the Sun2011-05-22T18:14:00+00:00 24 MB 
[TXT]Pastrol Counselling2011-05-23T15:33:00+00:00 21 MB 
[TXT]Data Dayal Maharishi Shiv Brat Lal Verman 1st Edition2011-05-24T12:52:00+00:00 17 MB 
[TXT]How to Export : As per New Exim Policy and Procedures April 2000-012011-05-25T10:11:00+00:00 24 MB 
[TXT]How to Import - 2000-012011-05-26T07:30:00+00:00 20 MB 
[TXT]Zen and Japanese Buddhism 3rd Edition2011-05-27T04:49:00+00:00 22 MB 
[TXT]Radiant Himalayas 1st Edition2011-05-28T02:08:00+00:00 19 MB 
[TXT]Coromandel Fishermen An Ethnography of Pattanavar Subcaste2011-05-28T23:27:00+00:00 22 MB 
[TXT]Show What You Know on the MSP Math Flash Cards Grade 4 Mathematic2011-05-29T20:46:00+00:00 22 MB 
[TXT]The Psychological Meaning of Chaos Translating Theory Into Practice 1st Edition2011-05-30T18:05:00+00:00 25 MB 
[TXT]Rural Energy Matters The Dhanawas Experience Reprint2011-05-31T15:24:00+00:00 23 MB 
[TXT]The Assyrians and Their Neighbours2011-06-01T12:43:00+00:00 17 MB 
[TXT]Endgame2011-06-02T10:02:00+00:00 20 MB 
[TXT]The Wrong Answer Faster The Inside Story of Making the Machine that Trades Trillions2011-06-03T07:21:00+00:00 22 MB 
[TXT]Birdies, Pars, Bogeys2011-06-04T04:40:00+00:00 21 MB 
[TXT]Obesity Management2011-06-05T01:59:00+00:00 17 MB 
[TXT]An Alliance of Spirit Museum & School Partnerships2011-06-05T23:18:00+00:00 19 MB 
[TXT]Saving Grandmother's Face And Other Tales from Christian Teachers in China2011-06-06T20:37:00+00:00 21 MB 
[TXT]Autobiography of a Modern Prophet2011-06-07T17:56:00+00:00 18 MB 
[TXT]Theology and Praxis Epistemological Foundations2011-06-08T15:15:00+00:00 20 MB 
[TXT]Maya Amazing Inventions You Can Build Yourself with 25 Projects 2nd Edition2011-06-09T12:34:00+00:00 24 MB 
[TXT]Explore the Wild West! With 25 Great Projects2011-06-10T09:53:00+00:00 24 MB 
[TXT]If You Dont Like the Possum, Enjoy the Sweet Potatoes Some Principles for Travel along the Road of2011-06-11T07:12:00+00:00 22 MB 
[TXT]From the Sanctuary to the Streets How the Dreams of One City&apo2011-06-12T04:31:00+00:00 19 MB 
[TXT]The Healing Power of Reiki A Modern Master's Approach to Emotional, Spi2011-06-13T01:50:00+00:00 18 MB 
[TXT]Cunningham's Magical Sampler Collected2011-06-13T23:09:00+00:00 23 MB 
[TXT]Four Square Writing in the Content Areas for Grades 5-92011-06-14T20:28:00+00:00 17 MB 
[TXT]The Medallion of Solaus2011-06-15T17:47:00+00:00 21 MB 
[TXT]The Stones Release2011-06-16T15:06:00+00:00 25 MB 
[TXT]The Signs of a Prophet The Prophetic Actions of Jesus2011-06-17T12:25:00+00:00 23 MB 
[TXT]Revival Preachers and Politics in Thirteenth Century Italy The Great Devotion of 12332011-06-18T09:44:00+00:00 20 MB 
[TXT]A History of Optics from Greek Antiquity to the Nineteenth Century2011-06-19T07:03:00+00:00 19 MB 
[TXT]Knight Everlasting2011-06-20T04:22:00+00:00 24 MB 
[TXT]In My Father&2011-06-21T01:41:00+00:00 23 MB 
[TXT]Translational Neuroscience A Guide to a Successful Program2011-06-21T23:00:00+00:00 20 MB 
[TXT]All in the Family On Community and Incommensurability2011-06-22T20:19:00+00:00 19 MB 
[TXT]The Way of Science Finding Truth and Meaning in a Scientific Worldview2011-06-23T17:38:00+00:00 17 MB 
[TXT]China Airborne2011-06-24T14:57:00+00:00 20 MB 
[TXT]So Brilliantly Clever Parker, Hulme & The Murder That Shocked The World2011-06-25T12:16:00+00:00 17 MB 
[TXT]Lessons In Letting Go Confessions Of A Hoarder2011-06-26T09:35:00+00:00 25 MB 
[TXT]For All Practical Purposes Mathematical Literacy In Today's Wor2011-06-27T06:54:00+00:00 20 MB 
[TXT]Betting on China Chinese Stocks, American Stock Markets, and the Wagers on a New Dynamic in Global C2011-06-28T04:13:00+00:00 24 MB 
[TXT]A Different Inequality The Politics Of Debate About Remote Aboriginal Australia2011-06-29T01:32:00+00:00 24 MB 
[TXT]White Ginger2011-06-29T22:51:00+00:00 21 MB 
[TXT]The Diamond Deep2011-06-30T20:10:00+00:00 21 MB 
[TXT]Spook: Science Tackles the Afterlife2011-07-01T17:29:00+00:00 17 MB 
[TXT]Quantum Coin2011-07-02T14:48:00+00:00 20 MB 
[TXT]World Regional Geography Concepts2011-07-03T12:07:00+00:00 19 MB 
[TXT]The Doctor and the Dinosaurs A Weird West Tale2011-07-04T09:26:00+00:00 23 MB 
[TXT]The Real Story of Risk Adventures in a Hazardous World2011-07-05T06:45:00+00:00 23 MB 
[TXT]Shadows2011-07-06T04:04:00+00:00 24 MB 
[TXT]Genoa and the Sea Policy and Power in an Early Modern Maritime Republic, 155916842011-07-07T01:23:00+00:00 17 MB 
[TXT]Jack of Ravens2011-07-07T22:42:00+00:00 17 MB 
[TXT]Queer in Russia A Story of Sex, Self, and the Other2011-07-08T20:01:00+00:00 23 MB 
[TXT]Back to Delphi2011-07-09T17:20:00+00:00 25 MB 
[TXT]Viva La Pizza! Pizza Boxes from Around the World2011-07-10T14:39:00+00:00 21 MB 
[TXT]Shudraka Sanskrit Writer2011-07-11T11:58:00+00:00 24 MB 
[TXT]Instructional Modules for AIDS Education2011-07-12T09:17:00+00:00 24 MB 
[TXT]India & Hungary Perspectives on the Changing World Order2011-07-13T06:36:00+00:00 23 MB 
[TXT]Studies on Man Issues and Challenges2011-07-14T03:55:00+00:00 24 MB 
[TXT]Education Changing Scenario2011-07-15T01:14:00+00:00 22 MB 
[TXT]Monetary Management in India2011-07-15T22:33:00+00:00 18 MB 
[TXT]New Dimensions in Indo-Burmese Relations2011-07-16T19:52:00+00:00 18 MB 
[TXT]Encyclopaedic Dictionary of Geology2011-07-17T17:11:00+00:00 18 MB 
[TXT]Parental Involvement in the Education of Mentally Handicapped Children2011-07-18T14:30:00+00:00 24 MB 
[TXT]Angels in the Fire The Dramatic True Story of an Impossible Rescue2011-07-19T11:49:00+00:00 24 MB 
[TXT]The Olympics Strangest Moments Extraordinary But True Tales From The History Of The Olympic Games2011-07-20T09:08:00+00:00 23 MB 
[TXT]The Rebirth of the Church Applying Paul's Vision for Ministry in Ou2011-07-21T06:27:00+00:00 23 MB 
[TXT]Fairy Tail 292011-07-22T03:46:00+00:00 25 MB 
[TXT]Introducing Apologetics Cultivating Christian Commitment2011-07-23T01:05:00+00:00 21 MB 
[TXT]Hard Man Hard Game2011-07-23T22:24:00+00:00 25 MB 
[TXT]First Date2011-07-24T19:43:00+00:00 20 MB 
[TXT]Besmel A Novel of the Iran-Iraq War2011-07-25T17:02:00+00:00 24 MB 
[TXT]Do What Jesus Did A Real-Life Field Guide to Healing the Sick, Routing Demons and Changing Lives For2011-07-26T14:21:00+00:00 18 MB 
[TXT]The Poetry Of Snowdonia2011-07-27T11:40:00+00:00 21 MB 
[TXT]Organic Chemistry, Solution Manual/Study Guide &2011-07-28T08:59:00+00:00 21 MB 
[TXT]Every Changing Shape2011-07-29T06:18:00+00:00 23 MB 
[TXT]HIV/AIDS Prevention : Education for Educational Institutions2011-07-30T03:37:00+00:00 25 MB 
[TXT]Women's Equality in India A Myth or Reality 1st Edition2011-07-31T00:56:00+00:00 21 MB 
[TXT]Battle in the Sky2011-07-31T22:15:00+00:00 18 MB 
[TXT]Intellect on Hold Awakening the Spirit2011-08-01T19:34:00+00:00 25 MB 
[TXT]Panchayati Raj Institutions and Role of NGOs : The Experience in Mysore and Tumkur Districts of Karn2011-08-02T16:53:00+00:00 23 MB 
[TXT]Meditation for Your Life Creating a Plan that Suits Your Style2011-08-03T14:12:00+00:00 24 MB 
[TXT]Covenant and Creation A Theology of Old Testament Covenants2011-08-04T11:31:00+00:00 18 MB 
[TXT]Is Mormonism Now Christian?2011-08-05T08:50:00+00:00 17 MB 
[TXT]Plunging into the Kingdom Way Practicing the Shared Strokes of Community, Hospitality, Justice, and2011-08-06T06:09:00+00:00 25 MB 
[TXT]From the Dust2011-08-07T03:28:00+00:00 24 MB 
[TXT]Trinitarian Theology after Barth2011-08-08T00:47:00+00:00 25 MB 
[TXT]Economic Development and Status of Women in India The Case of Haryana 1st Edition2011-08-08T22:06:00+00:00 17 MB 
[TXT]Dr. B.R. Ambedkar More Than a Dalit Voice2011-08-09T19:25:00+00:00 24 MB 
[TXT]India's Legendary East Coast2011-08-10T16:44:00+00:00 19 MB 
[TXT]TextBook of Engineering Mathematics, Vol. 12011-08-11T14:03:00+00:00 17 MB 
[TXT]The Widening Gyre Post Modern Crisis and Yeat's Vision2011-08-12T11:22:00+00:00 24 MB 
[TXT]Remembering Tibet The Paintings of Sonam Dhoudup, Catalogue of a Painting Exhibition held in Dharam2011-08-13T08:41:00+00:00 17 MB 
[TXT]Indian and Global Crises of Man Society, Culture and Civilisation Yesterday, Today and Tomorrow2011-08-14T06:00:00+00:00 17 MB 
[TXT]Human Resource Management Perspectives for the New Era 1st Edition2011-08-15T03:19:00+00:00 20 MB 
[TXT]Metal Implements in Ancient India From Earliest Time Upto Circa 2nd Century B.C. 1st Edition2011-08-16T00:38:00+00:00 18 MB 
[TXT]Contemporary Political Thinking2011-08-16T21:57:00+00:00 17 MB 
[TXT]Direct Taxes Law and Practice - 2000-2001 35th Edition2011-08-17T19:16:00+00:00 17 MB 
[TXT]Tourists Consumption Pattern and Its Economic Impact in Nepal2011-08-18T16:35:00+00:00 21 MB 
[TXT]Women and Marriage 1st Edition2011-08-19T13:54:00+00:00 25 MB 
[TXT]The Global World of Indian Merchants, 1750-1947 Traders of Sind from Bukhara to Panama 1st Published2011-08-20T11:13:00+00:00 21 MB 
[TXT]HRD for Local Government : Training Agenda for Municipal Bodies2011-08-21T08:32:00+00:00 18 MB 
[TXT]Alternative Economic Survey, 1998-2000 Two Years of Market Fundamentalism2011-08-22T05:51:00+00:00 24 MB 
[TXT]Applied Microbiology 1st Published2011-08-23T03:10:00+00:00 17 MB 
[TXT]Coordination Chemistry2011-08-24T00:29:00+00:00 18 MB 
[TXT]A Critique of the Nuclear Programme2011-08-24T21:48:00+00:00 20 MB 
[TXT]Women in Politics 1st Edition2011-08-25T19:07:00+00:00 20 MB 
[TXT]Economics Reforms and Poverty Reduction 1st Edition2011-08-26T16:26:00+00:00 25 MB 
[TXT]Widowhood A Curse to Humanity 1st Edition2011-08-27T13:45:00+00:00 19 MB 
[TXT]Race : Ethnicity and Women 1st Edition2011-08-28T11:04:00+00:00 21 MB 
[TXT]Rethinking Indian English Literature2011-08-29T08:23:00+00:00 25 MB 
[TXT]Indian Education into Millennium2011-08-30T05:42:00+00:00 20 MB 
[TXT]Modern English Literature, 1798-19192011-08-31T03:01:00+00:00 24 MB 
[TXT]Finance and Economic Innovations2011-09-01T00:20:00+00:00 18 MB 
[TXT]Food and Community Nutrition 1st Edition2011-09-01T21:39:00+00:00 22 MB 
[TXT]Health and Meal Management2011-09-02T18:58:00+00:00 17 MB 
[TXT]Integrated Watershed Management Productive and Sustainable Development2011-09-03T16:17:00+00:00 18 MB 
[TXT]Leadership in Industrial Setting2011-09-04T13:36:00+00:00 23 MB 
[TXT]Sociology of Indian Literature A Sociological Study of Hindi Novels2011-09-05T10:55:00+00:00 19 MB 
[TXT]Ethnicity in Urban Context The Gujaratis in Madras City2011-09-06T08:14:00+00:00 21 MB 
[TXT]Class Formation and Peasantry2011-09-07T05:33:00+00:00 19 MB 
[TXT]The Yoga and its Objects 11th Edition2011-09-08T02:52:00+00:00 21 MB 
[TXT]Gribov Memorial Volume Quarks, Hadrons, and Strong Interactions : Proceedings of the Memorial Worksh2011-09-09T00:11:00+00:00 19 MB 
[TXT]Cricket Oddities2011-09-09T21:30:00+00:00 20 MB 
[TXT]Enciclopedia Del Vino2011-09-10T18:49:00+00:00 20 MB 
[TXT]The As/400 Programmer's Handbook A Toolbox Of Examples For Every As/400 Programmer2011-09-11T16:08:00+00:00 23 MB 
[TXT]The Glory of Heaven Inspiring True Stories and Answers to Common Questions2011-09-12T13:27:00+00:00 18 MB 
[TXT]Education in India2011-09-13T10:46:00+00:00 22 MB 
[TXT]Media Education Reprint2011-09-14T08:05:00+00:00 21 MB 
[TXT]Role of Microbes in the Management of Environmental Pollution 1st Edition2011-09-15T05:24:00+00:00 24 MB 
[TXT]Goa's Foremost Nationalist Jose Inacio Candido de Loyola (The Man and His Writings)2011-09-16T02:43:00+00:00 19 MB 
[TXT]Social Justice and Empowerment2011-09-17T00:02:00+00:00 17 MB 
[TXT]Democracy in Danger Criminality and Corruption in Lok Sabha Elections2011-09-17T21:21:00+00:00 18 MB 
[TXT]Handbook of Journalism Style and Substance 2nd Edition2011-09-18T18:40:00+00:00 24 MB 
[TXT]C.Y. Chintamani The Unique Administrator and Journalist2011-09-19T15:59:00+00:00 17 MB 
[TXT]Immunobiology2011-09-20T13:18:00+00:00 24 MB 
[TXT]Raja Rao An Anthology of Recent Criticism 1st Edition2011-09-21T10:37:00+00:00 20 MB 
[TXT]Rise of Maratha Power in India 1st Edition2011-09-22T07:56:00+00:00 24 MB 
[TXT]Buddhist Art in India2011-09-23T05:15:00+00:00 19 MB 
[TXT]Nuclear Diplomacy The Art of the Deal2011-09-24T02:34:00+00:00 25 MB 
[TXT]Principles of Guidance and Counselling2011-09-24T23:53:00+00:00 25 MB 
[TXT]Women in the Buddhist Legends 1st Edition2011-09-25T21:12:00+00:00 23 MB 
[TXT]The Path to Enlightenment Svayambhu Stotra 1st Edition2011-09-26T18:31:00+00:00 22 MB 
[TXT]Trade and Development Report 1999 Fragile Recovery and Risks Trade, Finance ad Growth2011-09-27T15:50:00+00:00 19 MB 
[TXT]Glimpses of Sri Lankan Buddhism 1st Edition2011-09-28T13:09:00+00:00 17 MB 
[TXT]Stalking Terror : Land Mines in Peace and in War2011-09-29T10:28:00+00:00 22 MB 
[TXT]Citizenship Development Western Mores Eastern Values2011-09-30T07:47:00+00:00 23 MB 
[TXT]The Mahadev Kolis2011-10-01T05:06:00+00:00 20 MB 
[TXT]Inter-Racial Marriages in London2011-10-02T02:25:00+00:00 18 MB 
[TXT]Management-White Collar Relations2011-10-02T23:44:00+00:00 21 MB 
[TXT]The Marathi Theatre2011-10-03T21:03:00+00:00 18 MB 
[TXT]President Zakir Husain A Quest for Excellence2011-10-04T18:22:00+00:00 22 MB 
[TXT]Theory of Profit2011-10-05T15:41:00+00:00 25 MB 
[TXT]Vanishing Forests2011-10-06T13:00:00+00:00 25 MB 
[TXT]The Indian Economic Conference Papers 1979 Savings Behaviour in India2011-10-07T10:19:00+00:00 17 MB 
[TXT]South Asia Towards Dynamism and Cooperation2011-10-08T07:38:00+00:00 20 MB 
[TXT]Regional Study of Industrial Development of Vidarbha2011-10-09T04:57:00+00:00 17 MB 
[TXT]Aid to Collaboration A Study in Indo-U.S. Economic Relations2011-10-10T02:16:00+00:00 24 MB 
[TXT]Groundnut Marketing2011-10-10T23:35:00+00:00 18 MB 
[TXT]Mediation, Concilation and Arbitration2011-10-11T20:54:00+00:00 17 MB 
[TXT]Agricultural Labour, Wages and Living Conditions in Meerut2011-10-12T18:13:00+00:00 17 MB 
[TXT]Perspectives in Pre-School Education2011-10-13T15:32:00+00:00 24 MB 
[TXT]Robert Frost2011-10-14T12:51:00+00:00 24 MB 
[TXT]Monarchy in Nepal Imprisonment to Glory Tribhuvan Era in Nepal2011-10-15T10:10:00+00:00 24 MB 
[TXT]Poems of Vinda2011-10-16T07:29:00+00:00 20 MB 
[TXT]Micro-corneal and Soft Contact Lenses Prescribing and Fitting Techniques2011-10-17T04:48:00+00:00 20 MB 
[TXT]Politics of Indian Economy2011-10-18T02:07:00+00:00 21 MB 
[TXT]Through the Indian Looking Glass2011-10-18T23:26:00+00:00 20 MB 
[TXT]In the City of Dazzling Distortions Stories 1st Edition2011-10-19T20:45:00+00:00 18 MB 
[TXT]Science of Archaeology in India2011-10-20T18:04:00+00:00 22 MB 
[TXT]Analysis of Friendship for the Next Millennium2011-10-21T15:23:00+00:00 21 MB 
[TXT]Encyclopaedia of Women in Sports2011-10-22T12:42:00+00:00 19 MB 
[TXT]WTO in the New Millennium Commentary, Case Law, Legal Texts2011-10-23T10:01:00+00:00 21 MB 
[TXT]Rural Development in Nagaland2011-10-24T07:20:00+00:00 19 MB 
[TXT]Handbook of Higher Education2011-10-25T04:39:00+00:00 24 MB 
[TXT]Green Politics, 19992011-10-26T01:58:00+00:00 22 MB 
[TXT]Culture, Democracy and Development2011-10-26T23:17:00+00:00 22 MB 
[TXT]Musikavamsamahakavyam Atulakavikrtam (Atulakavi's Musikavam2011-10-27T20:36:00+00:00 17 MB 
[TXT]China The Middle Way Of The Middle Kingdom2011-10-28T17:55:00+00:00 19 MB 
[TXT]Ligny's Lake The Race To Solve The Riddles Of A Vanishing Man2011-10-29T15:14:00+00:00 19 MB 
[TXT]Mariquilla En La Nieve2011-10-30T12:33:00+00:00 22 MB 
[TXT]Idealism, Pragmatism, and Feminism The Philosophy of Ella Lyman Cabot2011-10-31T09:52:00+00:00 20 MB 
[TXT]Dolled Up to Die A Novel2011-11-01T07:11:00+00:00 23 MB 
[TXT]Comparative Concepts, Profiles Themes and Movements2011-11-02T04:30:00+00:00 17 MB 
[TXT]Cost Accounting and Cost Control 4th Revised & Enlarged2011-11-03T01:49:00+00:00 20 MB 
[TXT]Bhartrhari The Grammarian 1st Published2011-11-03T23:08:00+00:00 20 MB 
[TXT]Gleanings of the Past and the Science Movement In the Diaries of Drs. Mahendralal and Amritalal Sirc2011-11-04T20:27:00+00:00 17 MB 
[TXT]Ramshankar Ray2011-11-05T17:46:00+00:00 18 MB 
[TXT]The Craft of Poe's Tales 1st Edition2011-11-06T15:05:00+00:00 24 MB 
[TXT]Grassland Techniques and Management 1st Edition2011-11-07T12:24:00+00:00 17 MB 
[TXT]Integrated Management of Plant Resources2011-11-08T09:43:00+00:00 17 MB 
[TXT]Morality and Religion A Critical Study 1st Edition2011-11-09T07:02:00+00:00 20 MB 
[TXT]Applied Biology2011-11-10T04:21:00+00:00 17 MB 
[TXT]A Textbook of Human Rights2011-11-11T01:40:00+00:00 21 MB 
[TXT]The Psychology of Reasoning2011-11-11T22:59:00+00:00 19 MB 
[TXT]She Had Some Horses: Poems2011-11-12T20:18:00+00:00 25 MB 
[TXT]The Neuroscience of Human Relationships: Attachment And the Developing Social Brain (Norton Series o2011-11-13T17:37:00+00:00 20 MB 
[TXT]The Dao of Neuroscience Combining Eastern and Western Principles for Optimal Therapeutic Change2011-11-14T14:56:00+00:00 25 MB 
[TXT]Lighthouses (Norton/Library of Congress Visual Sourcebooks in Architecture, Design & Enginee2011-11-15T12:15:00+00:00 17 MB 
[TXT]A Clockwork Orange Reprint2011-11-16T09:34:00+00:00 25 MB 
[TXT]Engaging Cinema: An Introduction to Film Studies2011-11-17T06:53:00+00:00 19 MB 
[TXT]The Norton Book of Science Fiction (Norton Book Of...)2011-11-18T04:12:00+00:00 19 MB 
[TXT]Palliative Care for the Elderly in India2011-11-19T01:31:00+00:00 25 MB 
[TXT]Feel Good & Bad Factor in diffrent sector2011-11-19T22:50:00+00:00 21 MB 
[TXT]Biopsychosocial Issues in Positive Health2011-11-20T20:09:00+00:00 20 MB 
[TXT]Higher Education Social Political and Economic Challenges2011-11-21T17:28:00+00:00 25 MB 
[TXT]Handbook of Research Methods in Tourism2011-11-22T14:47:00+00:00 23 MB 
[TXT]The Taliban Cricket Club2011-11-23T12:06:00+00:00 20 MB 
[TXT]Cost Audit Practice Manual2011-11-24T09:25:00+00:00 22 MB 
[TXT]Guide to Tax Audit As Amended by Finance Act 2011 6th Edition2011-11-25T06:44:00+00:00 19 MB 
[TXT]Company Law and Practice 16th Edition2011-11-26T04:03:00+00:00 18 MB 
[TXT]Encyclopaedia of Educational Development and Economic Reforms2011-11-27T01:22:00+00:00 24 MB 
[TXT]2012 TLVs and BEIs ACGIH, TLVs and BEIs 1st Edition2011-11-27T22:41:00+00:00 23 MB 
[TXT]Teaching Ethically Challenges and Opportunities2011-11-28T20:00:00+00:00 17 MB 
[TXT]Bowel Care & Digestive Disorders2011-11-29T17:19:00+00:00 23 MB 
[TXT]God Politics2011-11-30T14:38:00+00:00 21 MB 
[TXT]Question Bank for Agricultural Competitions Useful for JRF SRF NET CET and PhD2011-12-01T11:57:00+00:00 17 MB 
[TXT]Biodiversity and Insect Pests Key Issues for Sustainable Management2011-12-02T09:16:00+00:00 17 MB 
[TXT]English Literary Criticism and Indian Poetics (Upto 18th Century)2011-12-03T06:35:00+00:00 25 MB 
[TXT]True Stories of Mystic Places2011-12-04T03:54:00+00:00 21 MB 
[TXT]Sherlock Holmes (collection - 3)2011-12-05T01:13:00+00:00 17 MB 
[TXT]Maximum Maiden The Unauthorised Biography Of Iron Maiden2011-12-05T22:32:00+00:00 18 MB 
[TXT]The Woody Guthrie Story2011-12-06T19:51:00+00:00 25 MB 
[TXT]The American Red Cross from Clara Barton to the New Deal2011-12-07T17:10:00+00:00 20 MB 
[TXT]Vinacular A Wine Lover's A-Z2011-12-08T14:29:00+00:00 18 MB 
[TXT]The Riddle Of The Sands2011-12-09T11:48:00+00:00 20 MB 
[TXT]Collected Poems Greg Delanty, 1986-20062011-12-10T09:07:00+00:00 21 MB 
[TXT]The Lipizzaner2011-12-11T06:26:00+00:00 19 MB 
[TXT]John Dowie A Life In The Round2011-12-12T03:45:00+00:00 17 MB 
[TXT]Maximum Bon Jovi The Unauthorised Biography Of Bon Jovi2011-12-13T01:04:00+00:00 17 MB 
[TXT]Believing The Neuroscience of Fantasies, Fears and Convictions2011-12-13T22:23:00+00:00 21 MB 
[TXT]Grandma and Me at the Flea Los Meros Meros Remateros2011-12-14T19:42:00+00:00 20 MB 
[TXT]Ecology, Technology And Culture Essays In Environmental Philosophy2011-12-15T17:01:00+00:00 25 MB 
[TXT]Zippo A Dark Futuristic Novel2011-12-16T14:20:00+00:00 23 MB 
[TXT]This Wheel&a2011-12-17T11:39:00+00:00 17 MB 
[TXT]The Emerald City Of Oz2011-12-18T08:58:00+00:00 18 MB 
[TXT]Stories that Move Mountains Storytelling and Visual Design for Persuasive Presentations2011-12-19T06:17:00+00:00 19 MB 
[TXT]Uremic Toxins by Mass Spectrometry 1st Edition2011-12-20T03:36:00+00:00 19 MB 
[TXT]Nineteenth Century British and American Poetry (Second Half)2011-12-21T00:55:00+00:00 18 MB 
[TXT]Banking and Insurance 1st Edition2011-12-21T22:14:00+00:00 24 MB 
[TXT]Open Access Movement in the Age of Innovation and ICT 1st Edition2011-12-22T19:33:00+00:00 19 MB 
[TXT]Approaches to Teaching Shelly's Poetry2011-12-23T16:52:00+00:00 23 MB 
[TXT]Textbook of Algae2011-12-24T14:11:00+00:00 23 MB 
[TXT]Contemporary Issues in Public Accountability and Audit Institute of Public Auditors of India, New De2011-12-25T11:30:00+00:00 18 MB 
[TXT]Child Rights In the New Era2011-12-26T08:49:00+00:00 18 MB 
[TXT]My Body Slide n Hide2011-12-27T06:08:00+00:00 19 MB 
[TXT]The Cosmic Mountain in Canaan and the Old Testament2011-12-28T03:27:00+00:00 20 MB 
[TXT]Brand Equity Strategies2011-12-29T00:46:00+00:00 25 MB 
[TXT]Technology for Facility Managers The Impact of Cutting-Edge Technology on Facility Management2011-12-29T22:05:00+00:00 19 MB 
[TXT]Love You To Death - Season 4 The Unofficial Companion To The Vampire Diaries2011-12-30T19:24:00+00:00 23 MB 
[TXT]New Beginnings Ten Teachings For Making The Rest Of Your Life The Best Of Your Life2011-12-31T16:43:00+00:00 23 MB 
[TXT]Starfish Biology and Ecology of the Asteroidea2012-01-01T14:02:00+00:00 23 MB 
[TXT]L.P. Vidyarthi : Contribution to the Development of Anthropology2012-01-02T11:21:00+00:00 17 MB 
[TXT]The Cost of Discipleship : Meditations During Lent and Holy Week2012-01-03T08:40:00+00:00 21 MB 
[TXT]Ghostly Tyne And Wear2012-01-04T05:59:00+00:00 21 MB 
[TXT]Into the Whirlwind A Novel2012-01-05T03:18:00+00:00 17 MB 
[TXT]Triumvirate: McKim, Mead & W2012-01-06T00:37:00+00:00 17 MB 
[TXT]Zen of Seeing: Seeing/Drawing as Meditation2012-01-06T21:56:00+00:00 20 MB 
[TXT]A Mencken Chrestomathy: His Own Selection of His Choicest Writing2012-01-07T19:15:00+00:00 18 MB 
[TXT]The Best Nest (Beginner Books(R))2012-01-08T16:34:00+00:00 19 MB 
[TXT]Aliens for Breakfast2012-01-09T13:53:00+00:00 18 MB 
[TXT]The Little Rabbit (Pictureback(R))2012-01-10T11:12:00+00:00 18 MB 
[TXT]The Missing Tooth (Step into Reading, Step 3)2012-01-11T08:31:00+00:00 20 MB 
[TXT]Mike Mulligan and His Steam Shovel2012-01-12T05:50:00+00:00 20 MB 
[TXT]Ira Sleeps Over2012-01-13T03:09:00+00:00 21 MB 
[TXT]The Whingdingdilly2012-01-14T00:28:00+00:00 19 MB 
[TXT]The Scottish Heather Book2012-01-14T21:47:00+00:00 23 MB 
[TXT]Towards a Fuller Humanity : A Theological Reflection on Christian Understanding on Human Rights2012-01-15T19:06:00+00:00 23 MB 
[TXT]Problems of Ancient India 1st Edition2012-01-16T16:25:00+00:00 21 MB 
[TXT]V.N. Shukla's Constitution of India Reprint2012-01-17T13:44:00+00:00 25 MB 
[TXT]Handbook of Weaving 1st Indian Edition2012-01-18T11:03:00+00:00 21 MB 
[TXT]Environment, Energy, Health Planning for Conservation 1st Edition2012-01-19T08:22:00+00:00 19 MB 
[TXT]Land Development Banking in India2012-01-20T05:41:00+00:00 25 MB 
[TXT]Decentralised Planning for Development in India2012-01-21T03:00:00+00:00 22 MB 
[TXT]Foreign Trade Aid and Development in Nepal2012-01-22T00:19:00+00:00 17 MB 
[TXT]Foreign Aid and India's Economic Development2012-01-22T21:38:00+00:00 23 MB 
[TXT]Thrust Sectors in India's Exports 1st Edition2012-01-23T18:57:00+00:00 20 MB 
[TXT]Management Planning and Policy Making2012-01-24T16:16:00+00:00 22 MB 
[TXT]Educational Innovations Institutional Profiles and Case Studies 1st Edition2012-01-25T13:35:00+00:00 25 MB 
[TXT]Meaningful Interaction with Culturally Different Students2012-01-26T10:54:00+00:00 22 MB 
[TXT]Physics Education 1st Edition2012-01-27T08:13:00+00:00 25 MB 
[TXT]Caste and Politics in Bihar2012-01-28T05:32:00+00:00 19 MB 
[TXT]International Images and Structural Balance2012-01-29T02:51:00+00:00 24 MB 
[TXT]World War II Medical Services : India 1st Edition2012-01-30T00:10:00+00:00 24 MB 
[TXT]Accounting and Finance for Managers2012-01-30T21:29:00+00:00 23 MB 
[TXT]All You Wanted to Know About Meditation2012-01-31T18:48:00+00:00 23 MB 
[TXT]Human Well-Being Socio-Economic Indicators A Global Study2012-02-01T16:07:00+00:00 23 MB 
[TXT]In Search of Fair Play Street and Working Children Speak About their Rights2012-02-02T13:26:00+00:00 22 MB 
[TXT]Kasturba Gandhi The Sage of Satyagraha 1st Edition2012-02-03T10:45:00+00:00 17 MB 
[TXT]Indian Beauty Secrets Pamper Your Body and Soul 1st Indian Edition2012-02-04T08:04:00+00:00 17 MB 
[TXT]Shivaji and the Emergence of Marathas2012-02-05T05:23:00+00:00 21 MB 
[TXT]A Stylistic and Semantic Study of Two Partition Novels 1st Edition2012-02-06T02:42:00+00:00 20 MB 
[TXT]Banaras Visions of a Living Ancient Tradition2012-02-07T00:01:00+00:00 19 MB 
[TXT]The Lion of Parliament Dr. Syama Prasad Mookerjee 1st Edition2012-02-07T21:20:00+00:00 22 MB 
[TXT]Managing Human Resource Development An Indian Perspective2012-02-08T18:39:00+00:00 17 MB 
[TXT]Bank Finance to Corporate Sector in India2012-02-09T15:58:00+00:00 20 MB 
[TXT]Financial Management of Public Undertakings2012-02-10T13:17:00+00:00 22 MB 
[TXT]Financing of Public Enterprises and Public Participation2012-02-11T10:36:00+00:00 22 MB 
[TXT]Regional Rural Banks and Rural Development2012-02-12T07:55:00+00:00 18 MB 
[TXT]Company Directors Under Company Law2012-02-13T05:14:00+00:00 19 MB 
[TXT]Georges Sorel, His Thoughts and Works2012-02-14T02:33:00+00:00 23 MB 
[TXT]Political Science Annual - 1998-99 Focus on Political Theory2012-02-14T23:52:00+00:00 22 MB 
[TXT]Birthday Messages, 1955-79 2nd Edition2012-02-15T21:11:00+00:00 24 MB 
[TXT]Reality Behind Life 1st Edition2012-02-16T18:30:00+00:00 18 MB 
[TXT]Meditations Creative Visualization and Meditation Exercises to Enrich Your Life2012-02-17T15:49:00+00:00 20 MB 
[TXT]Teaching and Coaching Tennis2012-02-18T13:08:00+00:00 25 MB 
[TXT]Managing People Effectively : Managerial Experiences - 100 Case Studies2012-02-19T10:27:00+00:00 23 MB 
[TXT]Welfare, Choice and Development Essays in Honour of Professor Amartya Sen2012-02-20T07:46:00+00:00 20 MB 
[TXT]Administrators Missionaries and a World Turned Upside Down2012-02-21T05:05:00+00:00 25 MB 
[TXT]Quest for Justice Perspectives on Mission of Unity2012-02-22T02:24:00+00:00 19 MB 
[TXT]Chemistry of Transition Elements2012-02-22T23:43:00+00:00 21 MB 
[TXT]Molecular Genetics2012-02-23T21:02:00+00:00 22 MB 
[TXT]Tribal Women Empowerment and Gender Issues 1st Edition2012-02-24T18:21:00+00:00 21 MB 
[TXT]Research Trends in Modern Botany [Morphological, Anatomical, Embryological and Chemosystematic Studi2012-02-25T15:40:00+00:00 22 MB 
[TXT]We Have a Baby2012-02-26T12:59:00+00:00 22 MB 
[TXT]Katie And The Starry Night2012-02-27T10:18:00+00:00 20 MB 
[TXT]Mammon2012-02-28T07:37:00+00:00 20 MB 
[TXT]Curtiss P-40 Snub-Nosed Kittyhawks and Warhawks2012-02-29T04:56:00+00:00 18 MB 
[TXT]Haunted Tunbridge Wells2012-03-01T02:15:00+00:00 21 MB 
[TXT]The Black Rose Book Two In The Seven Stars Trilogy2012-03-01T23:34:00+00:00 17 MB 
[TXT]Food The Essential A-Z Guide2012-03-02T20:53:00+00:00 17 MB 
[TXT]Gold Coast Madam The Secret Life Of Rose Laws2012-03-03T18:12:00+00:00 21 MB 
[TXT]Distracted Settlement New South Wales After Bligh From The Journal Of Lieutenant James Finucane, 1802012-03-04T15:31:00+00:00 19 MB 
[TXT]Dog in the Manger2012-03-05T12:50:00+00:00 17 MB 
[TXT]La Jugueteria Errante Un Misterio Para Gervase Fen2012-03-06T10:09:00+00:00 18 MB 
[TXT]Global Warming and Climate Change2012-03-07T07:28:00+00:00 23 MB 
[TXT]Post Modern Literary Theory2012-03-08T04:47:00+00:00 21 MB 
[TXT]Benefits Management How to Increase the Business Value of Your It Projects2012-03-09T02:06:00+00:00 23 MB 
[TXT]Indirect Tax Law & Practice (June) 20092012-03-09T23:25:00+00:00 18 MB 
[TXT]Between a Mother and her Child2012-03-10T20:44:00+00:00 23 MB 
[TXT]Small Waterplane Area Ships2012-03-11T18:03:00+00:00 23 MB 
[TXT]Automated Management of Library Collection2012-03-12T15:22:00+00:00 25 MB 
[TXT]Family Planning Programme and Beyond Policy and Administration2012-03-13T12:41:00+00:00 22 MB 
[TXT]Education and Manpower Planning2012-03-14T10:00:00+00:00 17 MB 
[TXT]Long-Term Fiscal Policy and Planning in India2012-03-15T07:19:00+00:00 24 MB 
[TXT]Housing Laws in India Problems and Remedies : Covering; Flats and Apartments Promoters, Builders and2012-03-16T04:38:00+00:00 18 MB 
[TXT]Democracy in India2012-03-17T01:57:00+00:00 21 MB 
[TXT]WTO and the Indian Economy Reprint2012-03-17T23:16:00+00:00 21 MB 
[TXT]Philosophy of Wittgenstein India Responses 1st Edition2012-03-18T20:35:00+00:00 19 MB 
[TXT]Managing Multilingualism in India Political and Linguistics Manifestations 1st Published2012-03-19T17:54:00+00:00 21 MB 
[TXT]All You Wanted to Know About Dreams2012-03-20T15:13:00+00:00 19 MB 
[TXT]Eminent Indian English Writers An Assessment 1st Edition2012-03-21T12:32:00+00:00 17 MB 
[TXT]The Sociology of International Politics 1st Cosmo Print2012-03-22T09:51:00+00:00 23 MB 
[TXT]Recent Trends in Diseases Management of Fruits and Seeds 1st Edition2012-03-23T07:10:00+00:00 24 MB 
[TXT]World Economic and Social Survey, 2000 Trends and Policies in the World Economy2012-03-24T04:29:00+00:00 23 MB 
[TXT]For the Soul Thought2012-03-25T01:48:00+00:00 23 MB 
[TXT]Sarup's Dictionary of Biotechnology2012-03-25T23:07:00+00:00 22 MB 
[TXT]Problems in Finsler Space2012-03-26T20:26:00+00:00 22 MB 
[TXT]Wake up Laughing My Miraculous Life and Sai Baba2012-03-27T17:45:00+00:00 18 MB 
[TXT]Police Internal Security and Developmental Disorder in India2012-03-28T15:04:00+00:00 22 MB 
[TXT]Public Administration and the State2012-03-29T12:23:00+00:00 25 MB 
[TXT]President's Rule in India2012-03-30T09:42:00+00:00 19 MB 
[TXT]Macro Theories of Distribution2012-03-31T07:01:00+00:00 22 MB 
[TXT]Social Change and Violence The Indian Experience2012-04-01T04:20:00+00:00 17 MB 
[TXT]Tribal Development in India2012-04-02T01:39:00+00:00 21 MB 
[TXT]Islam and its Founder Indian Edition2012-04-02T22:58:00+00:00 23 MB 
[TXT]Secularism and Constitutionality2012-04-03T20:17:00+00:00 23 MB 
[TXT]Globalization and Nationalism The Changing Balance of India's Economic2012-04-04T17:36:00+00:00 25 MB 
[TXT]El Libro De Las Maravillas2012-04-05T14:55:00+00:00 17 MB 
[TXT]Ravi Likhda Hai2012-04-06T12:14:00+00:00 20 MB 
[TXT]Raising Hell Ken Russell And The Unmaking Of The Devils2012-04-07T09:33:00+00:00 19 MB 
[TXT]Panjwa Sahibzada2012-04-08T06:52:00+00:00 23 MB 
[TXT]Roshnia Da Baghban2012-04-09T04:11:00+00:00 18 MB 
[TXT]Cinco Madres, Cinco Historias 2nd Edition2012-04-10T01:30:00+00:00 17 MB 
[TXT]Unfinished Lives Reviving the Memories of LGBTQ Hate Crimes Victims2012-04-10T22:49:00+00:00 25 MB 
[TXT]Cynic Sage or Son of God? Recovering the Real Jesus in an Age of Revisionist Replies2012-04-11T20:08:00+00:00 21 MB 
[TXT]Why Four Gospels?2012-04-12T17:27:00+00:00 23 MB 
[TXT]London - Eyewitness Travel Family Guide Illustrated Edition2012-04-13T14:46:00+00:00 17 MB 
[TXT]Paradigms Lost Fighting Stigma and the Lessons Learned2012-04-14T12:05:00+00:00 22 MB 
[TXT]Sarghi2012-04-15T09:24:00+00:00 23 MB 
[TXT]Battle Story Maiwand 18802012-04-16T06:43:00+00:00 18 MB 
[TXT]The Lost Grizzlies: A Search for Survivors in the Wilderness of Colorado2012-04-17T04:02:00+00:00 22 MB 
[TXT]Pink and Say2012-04-18T01:21:00+00:00 19 MB 
[TXT]Today Is Monday2012-04-18T22:40:00+00:00 24 MB 
[TXT]Cuaderno De Ejercicios Para Dormir Bien2012-04-19T19:59:00+00:00 23 MB 
[TXT]El Hombre Perro2012-04-20T17:18:00+00:00 21 MB 
[TXT]Gulabi Pagg2012-04-21T14:37:00+00:00 25 MB 
[TXT]The Rhino Keepers Struggle For Survival2012-04-22T11:56:00+00:00 18 MB 
[TXT]Panah2012-04-23T09:15:00+00:00 18 MB 
[TXT]El Tren2012-04-24T06:34:00+00:00 20 MB 
[TXT]How to Create the Perfect Wife Britain's Most Ineligible Bachelor and his Enlig2012-04-25T03:53:00+00:00 23 MB 
[TXT]Closing The Gap Lombardi, The Packers Dynasty, And The Pursuit Of Excellence2012-04-26T01:12:00+00:00 24 MB 
[TXT]Clinker Boat Building A Guide To Traditional Techniques2012-04-26T22:31:00+00:00 21 MB 
[TXT]Excel 2010 Business Basics & Beyond2012-04-27T19:50:00+00:00 25 MB 
[TXT]The Insightful Teacher Reflective Strategies To Shape Your Early Childhood Classroom2012-04-28T17:09:00+00:00 20 MB 
[TXT]Functional Equations and Inequalities in Several Variables2012-04-29T14:28:00+00:00 25 MB 
[TXT]Tribes of Assam and Manipur Reprint2012-04-30T11:47:00+00:00 22 MB 
[TXT]Kashmir The Constitutional Status 1st Edition2012-05-01T09:06:00+00:00 18 MB 
[TXT]Contemporary Indian Society (Part II) 1st Edition2012-05-02T06:25:00+00:00 18 MB 
[TXT]Realism and Revelation in Graham Greene 1st Edition2012-05-03T03:44:00+00:00 20 MB 
[TXT]Automobile Pollution2012-05-04T01:03:00+00:00 19 MB 
[TXT]In Their Shadows A Collection of Four Stories2012-05-04T22:22:00+00:00 19 MB 
[TXT]Story of the I.N.A. Reprint2012-05-05T19:41:00+00:00 20 MB 
[TXT]Human Rights Education Conceptual and Pedagogical Aspects 1st Edition2012-05-06T17:00:00+00:00 19 MB 
[TXT]Basic Structure and Constitutional Amendments Limitations and Justiciability2012-05-07T14:19:00+00:00 23 MB 
[TXT]Kindle Life Reprint2012-05-08T11:38:00+00:00 21 MB 
[TXT]Indian Rural Problems2012-05-09T08:57:00+00:00 25 MB 
[TXT]Frontiers of Anthropology 1st Edition2012-05-10T06:16:00+00:00 20 MB 
[TXT]Infrastructure Development Under Economic Reforms 1st Edition2012-05-11T03:35:00+00:00 17 MB 
[TXT]Naradasmrti Historical, Sociological, Political and Legal Study 1st Published2012-05-12T00:54:00+00:00 18 MB 
[TXT]Writings of Allama Abdullah Yusuf Ali2012-05-12T22:13:00+00:00 19 MB 
[TXT]Al-Hadiyato-Linnisa Islamic Laws Regarding Purity for Women 1st Edition2012-05-13T19:32:00+00:00 24 MB 
[TXT]Library Preservation and Automation 1st Edition2012-05-14T16:51:00+00:00 23 MB 
[TXT]Dr. H.S. Gour's Law Relating to Theft, Robbery and Dacoity Alon2012-05-15T14:10:00+00:00 25 MB 
[TXT]The Zombie Tarot An Oracle of the Undead with Deck and Instructions2012-05-16T11:29:00+00:00 19 MB 
[TXT]Dynamics of Non-Formal Education 1st Edition2012-05-17T08:48:00+00:00 24 MB 
[TXT]Meditation : Simran 1st Reprint2012-05-18T06:07:00+00:00 20 MB 
[TXT]Living Words Soul-Kindlers for the New Millennium : Gleanings form the Works of Sri Aurobindo and th2012-05-19T03:26:00+00:00 22 MB 
[TXT]All in a Stride Reflections of a Civil Servant 1st Edition2012-05-20T00:45:00+00:00 24 MB 
[TXT]The Black Book of Gujarat 1st Edition2012-05-20T22:04:00+00:00 20 MB 
[TXT]Coaching Successfully Basketball2012-05-21T19:23:00+00:00 17 MB 
[TXT]Coaching Successfully Weight Training2012-05-22T16:42:00+00:00 19 MB 
[TXT]Medicine and Life Sciences in India Vol. 4, Part 2 Reprint2012-05-23T14:01:00+00:00 21 MB 
[TXT]The Indian Air Force A Balanced Strategic and Tactical Application2012-05-24T11:20:00+00:00 21 MB 
[TXT]Islamic Views on Human Rights Viewpoints of Iranian Scholars 1st Indian Edition2012-05-25T08:39:00+00:00 20 MB 
[TXT]Food Science and Applications in Indian Cookery 1st Edition2012-05-26T05:58:00+00:00 20 MB 
[TXT]Good News New Testament with Psalms2012-05-27T03:17:00+00:00 24 MB 
[TXT]Quotes and Anecdotes An Anthology for Preachers & Teachers 7th Print2012-05-28T00:36:00+00:00 19 MB 
[TXT]Israel in the Old Testament2012-05-28T21:55:00+00:00 17 MB 
[TXT]Here and Now : Living in the Spirit2012-05-29T19:14:00+00:00 20 MB 
[TXT]New Girl Law Drafting A Future For Cambodia2012-05-30T16:33:00+00:00 25 MB 
[TXT]Devotion to the Divine Mercy of God (Novena & Chaplet)2012-05-31T13:52:00+00:00 19 MB 
[TXT]Mary : Star of the New Millennium Guiding Us to Renewal Reprint2012-06-01T11:11:00+00:00 17 MB 
[TXT]Southeast Asian/American Studies2012-06-02T08:30:00+00:00 18 MB 
[TXT]The Voice and the Will Subaltern Agency : Forms and Motives 1st Edition2012-06-03T05:49:00+00:00 18 MB 
[TXT]Managing for Value2012-06-04T03:08:00+00:00 21 MB 
[TXT]On Cleaning Bookshelves 1st Published2012-06-05T00:27:00+00:00 20 MB 
[TXT]Supreme Court Yearly Digest, 2001 With Table of Overruled, Reversed, Followed, etc., Cases, List of2012-06-05T21:46:00+00:00 17 MB 
[TXT]Conservation Science 1st Published2012-06-06T19:05:00+00:00 19 MB 
[TXT]Business Methods and Machinery2012-06-07T16:24:00+00:00 18 MB 
[TXT]Economic Geography of India2012-06-08T13:43:00+00:00 19 MB 
[TXT]Manipur The Jewel of India 1st Edition2012-06-09T11:02:00+00:00 25 MB 
[TXT]Information Technology in Higher Education2012-06-10T08:21:00+00:00 23 MB 
[TXT]Restaurant Management 1st Edition2012-06-11T05:40:00+00:00 22 MB 
[TXT]The Art of Commonsense Living 2nd Print2012-06-12T02:59:00+00:00 22 MB 
[TXT]Rural Women and Grassroot Organisations Expectations and Outcomes2012-06-13T00:18:00+00:00 19 MB 
[TXT]Staff and Service Management2012-06-13T21:37:00+00:00 25 MB 
[TXT]Ramacaritamanasa in South Africa 1st Edition2012-06-14T18:56:00+00:00 17 MB 
[TXT]Rural Economy and Society Study of South-Eastern Rajasthan During the Eighteenth Century2012-06-15T16:15:00+00:00 21 MB 
[TXT]The Country of the Sikhs Punjab (The Punjab Under the Sikh Rule, 1799 AD to 1849 AD)2012-06-16T13:34:00+00:00 22 MB 
[TXT]Jane Austen's Heroes And Other Male Characters : A Sociological2012-06-17T10:53:00+00:00 18 MB 
[TXT]Sanjeev Kapoor's Any Time Temptations 2nd R2012-06-18T08:12:00+00:00 25 MB 
[TXT]Religious Thought in India 1st Edition2012-06-19T05:31:00+00:00 25 MB 
[TXT]Aquarium Fish Keeping 1st Edition2012-06-20T02:50:00+00:00 25 MB 
[TXT]A Glossary of Some Terms Used in Development and Planning2012-06-21T00:09:00+00:00 22 MB 
[TXT]A Glossary of Terms in Regional Planning and Development2012-06-21T21:28:00+00:00 20 MB 
[TXT]Computer Fundamentals and Programming 1st Edition2012-06-22T18:47:00+00:00 18 MB 
[TXT]A First Course in Programming with C Reprint2012-06-23T16:06:00+00:00 21 MB 
[TXT]Seducing Pain 1st Edition2012-06-24T13:25:00+00:00 19 MB 
[TXT]Lord Lawrence and Reconstruction of India Under the Crown2012-06-25T10:44:00+00:00 20 MB 
[TXT]Phases of Indian Civilization A Historical and Cultural Outline2012-06-26T08:03:00+00:00 19 MB 
[TXT]Child Labour in India 1st Edition2012-06-27T05:22:00+00:00 19 MB 
[TXT]Women in India An Exhaustive Study 1st Edition2012-06-28T02:41:00+00:00 22 MB 
[TXT]Punjab Fairs and Festivals2012-06-29T00:00:00+00:00 21 MB 
[TXT]Birsa Munda and His Movement, 1872-1901 A Study of a Millenarian Movement in Chotanagpur A Centennia2012-06-29T21:19:00+00:00 25 MB 
[TXT]Conversions and Citizenry Goa Under Portugal 1510-1610 1st Edition2012-06-30T18:38:00+00:00 25 MB 
[TXT]Sex Education 9th Print2012-07-01T15:57:00+00:00 19 MB 
[TXT]Current Issues in Modern Education 1st Edition2012-07-02T13:16:00+00:00 19 MB 
[TXT]Where I Want to Be2012-07-03T10:35:00+00:00 25 MB 
[TXT]Peace, Locomotion2012-07-04T07:54:00+00:00 19 MB 
[TXT]Leaves2012-07-05T05:13:00+00:00 21 MB 
[TXT]Sex Over 502012-07-06T02:32:00+00:00 17 MB 
[TXT]It's Not about Food End You2012-07-06T23:51:00+00:00 17 MB 
[TXT]Weather Whys2012-07-07T21:10:00+00:00 20 MB 
[TXT]Social Development and Planning in Asia 1st Edition2012-07-08T18:29:00+00:00 20 MB 
[TXT]Psychology of Reading Role of Orthographic Features 1st Edition2012-07-09T15:48:00+00:00 20 MB 
[TXT]Economic Development and Political Democracy The Interaction of Economics and Politics in Independen2012-07-10T13:07:00+00:00 17 MB 
[TXT]Taxmann's Natural Justice, Judicial Review &2012-07-11T10:26:00+00:00 23 MB 
[TXT]Climate, Weather and Crops in India2012-07-12T07:45:00+00:00 25 MB 
[TXT]Appreciation Programme for Senior Executives on Recent Developments in Rock Mechanics and Tunnelling2012-07-13T05:04:00+00:00 23 MB 
[TXT]Transformation of Herbicidal Technology Chemical Based to Ecological Concern 1st Edition2012-07-14T02:23:00+00:00 25 MB 
[TXT]The Taste Divine Indian Vegetarian Cooking the Natural Way2012-07-14T23:42:00+00:00 21 MB 
[TXT]Abelardian Semiotics and Other Essays2012-07-15T21:01:00+00:00 20 MB 
[TXT]Abuse of Christian Woman in India and Remedy in 12 Biblical Studies on Equality of Man and Woman 2nd2012-07-16T18:20:00+00:00 20 MB 
[TXT]Basic Ideas in Educational Psychology 2nd Edition2012-07-17T15:39:00+00:00 17 MB 
[TXT]Food Processing Biotechnological Applications 1st Edition2012-07-18T12:58:00+00:00 22 MB 
[TXT]Competitive Advantage Through Knowledge Management 1st Edition2012-07-19T10:17:00+00:00 25 MB 
[TXT]St. Anthony of Padua A Warm-Hearted Saint2012-07-20T07:36:00+00:00 21 MB 
[TXT]Perspective on Current Affairs 1st Edition2012-07-21T04:55:00+00:00 21 MB 
[TXT]A Textbook of Indian Tourism2012-07-22T02:14:00+00:00 20 MB 
[TXT]Teaching Languages to Young Learners2012-07-22T23:33:00+00:00 19 MB 
[TXT]New Century : Whose Century? The Evolution and Interaction of Technology, Economy, Polity and Societ2012-07-23T20:52:00+00:00 18 MB 
[TXT]Development Strategies for Library and Information Science2012-07-24T18:11:00+00:00 22 MB 
[TXT]Introduction to Computers and Basic Programming 2nd Edition2012-07-25T15:30:00+00:00 23 MB 
[TXT]Special Functions Selected Articles-Proceedings of the First National Conference of the Society for2012-07-26T12:49:00+00:00 22 MB 
[TXT]Sakti Cult in Orissa 1st Published2012-07-27T10:08:00+00:00 17 MB 
[TXT]Asia and Twice Born Prometheus Historical Epic Revealed 1st Edition2012-07-28T07:27:00+00:00 25 MB 
[TXT]Renewables Products and Markets2012-07-29T04:46:00+00:00 17 MB 
[TXT]Hindu Dances2012-07-30T02:05:00+00:00 23 MB 
[TXT]The Nature of Living Tradition Distinctive Features of Indian Parampara 1st Edition2012-07-30T23:24:00+00:00 23 MB 
[TXT]Managing the Indian State National2012-07-31T20:43:00+00:00 22 MB 
[TXT]Japanese Street Style 1st Edition2012-08-01T18:02:00+00:00 25 MB 
[TXT]In the Land of Jesus A Travelogue2012-08-02T15:21:00+00:00 18 MB 
[TXT]The Picture Book2012-08-03T12:40:00+00:00 20 MB 
[TXT]Fractures and Their Complications2012-08-04T09:59:00+00:00 21 MB 
[TXT]Ocean Life2012-08-05T07:18:00+00:00 21 MB 
[TXT]The Philosophical Life Twelve Great Thinkers and the Search for Wisdom, from Socrates to Nietzsche I2012-08-06T04:37:00+00:00 23 MB 
[TXT]Correct English Usage2012-08-07T01:56:00+00:00 22 MB 
[TXT]Economic Developments in India (EDI) : Monthly Update, Volume 52 Analysis, Reports, Policy Documents2012-08-07T23:15:00+00:00 25 MB 
[TXT]Encyclopaedic Dictionary of Science2012-08-08T20:34:00+00:00 22 MB 
[TXT]Into the Heart of Faith : Ten Steps on the Journey2012-08-09T17:53:00+00:00 21 MB 
[TXT]The Cambridge Companion to Wittgenstein2012-08-10T15:12:00+00:00 17 MB 
[TXT]Patterns of Speculation A Study in Observational Econophysics 1st Edition2012-08-11T12:31:00+00:00 22 MB 
[TXT]In the Wonderland of Investment for NRIs Financial Year, 2003-2004, Assessment Year, 2004-2005 4th R2012-08-12T09:50:00+00:00 19 MB 
[TXT]Common Symptoms Effective Remedies 2nd Edition2012-08-13T07:09:00+00:00 20 MB 
[TXT]History of Biology2012-08-14T04:28:00+00:00 24 MB 
[TXT]Corporate Instinct2012-08-15T01:47:00+00:00 22 MB 
[TXT]Intranets2012-08-15T23:06:00+00:00 18 MB 
[TXT]Prem Chand Hindi Novelist and Story-Writer2012-08-16T20:25:00+00:00 22 MB 
[TXT]Bharatiya Samskriti Spectrum of India's Culture 1st Edi2012-08-17T17:44:00+00:00 21 MB 
[TXT]Bhagavad Gita for 21st Century Way to Add Years to Life and Add Life to Years 1st Edition2012-08-18T15:03:00+00:00 18 MB 
[TXT]Extraordinary Performances from Ordinary People2012-08-19T12:22:00+00:00 21 MB 
[TXT]Malavikagnimitra of Kalidasa Edited With a Complete Translation Into English, Notes (Critical and E2012-08-20T09:41:00+00:00 23 MB 
[TXT]United Nations and Indian Mysticism Parallels on Human Rights and Police 1st Edition2012-08-21T07:00:00+00:00 25 MB 
[TXT]Exploring Spirituality A Step-by-Step Guide to Finding and Following Your Own Spiritual Path Reprint2012-08-22T04:19:00+00:00 23 MB 
[TXT]Environmental Perspectives in India 1st Edition2012-08-23T01:38:00+00:00 17 MB 
[TXT]Ecclesia Divina or A Selection of Hymns From the Four Vedas Reprint2012-08-23T22:57:00+00:00 20 MB 
[TXT]Atomic Structure 1st Edition2012-08-24T20:16:00+00:00 17 MB 
[TXT]Jurisprudence and Legal Theory 3rd Edition, Reprint2012-08-25T17:35:00+00:00 21 MB 
[TXT]Glossary of Terms and Expressions in Sales Tax With Supplement2012-08-26T14:54:00+00:00 21 MB 
[TXT]Sri Shivsahasranamavali (Stotram & Namavali)2012-08-27T12:13:00+00:00 20 MB 
[TXT]Supreme Court Yearly Digest, 2002 With table of Overruled, Reversed, Followed, etc. Cases, List of A2012-08-28T09:32:00+00:00 24 MB 
[TXT]A Text Book of Marketing Research 1st Edition2012-08-29T06:51:00+00:00 20 MB 
[TXT]Global Human Growth Model 1st Edition2012-08-30T04:10:00+00:00 19 MB 
[TXT]Office Organisaton and Management 1st Edition2012-08-31T01:29:00+00:00 25 MB 
[TXT]Mercantile Law and Indutrial Law 1st Edition2012-08-31T22:48:00+00:00 18 MB 
[TXT]Kalidas Bhattacharyya 1st Edition2012-09-01T20:07:00+00:00 19 MB 
[TXT]Handbook of Libraries and Librarians in India 1st Edition2012-09-02T17:26:00+00:00 20 MB 
[TXT]Modern Principles of Athletic Training2012-09-03T14:45:00+00:00 20 MB 
[TXT]Public Administration in the New Millennium Challenges and Prospects 1st Edition2012-09-04T12:04:00+00:00 22 MB 
[TXT]Computer Applications in Management Reprint2012-09-05T09:23:00+00:00 25 MB 
[TXT]The Vedant Philosophy2012-09-06T06:42:00+00:00 17 MB 
[TXT]Sociology and Unpredictability in the Growth of Science and Technology2012-09-07T04:01:00+00:00 20 MB 
[TXT]Current Trends in Industrial and Applied Mathematics2012-09-08T01:20:00+00:00 20 MB 
[TXT]Food, Health and Vitamins2012-09-08T22:39:00+00:00 23 MB 
[TXT]God and Self-Realization A Scientific and Spiritual View 1st Indian Edition2012-09-09T19:58:00+00:00 25 MB 
[TXT]Management and Utilization of Bamboo and Rattan in Papua New Guinea2012-09-10T17:17:00+00:00 19 MB 
[TXT]Physical Education Foundation2012-09-11T14:36:00+00:00 21 MB 
[TXT]Verbal forms in the Rgveda 4th Mandala 1st Edition2012-09-12T11:55:00+00:00 24 MB 
[TXT]Dynamics of International Relations 1st Edition2012-09-13T09:14:00+00:00 20 MB 
[TXT]Engineering Graphics Anna University Syllabus-2004-5 5th Edition2012-09-14T06:33:00+00:00 17 MB 
[TXT]Bharat's Income Tax Act With Departmental Views (Containing Gist of2012-09-15T03:52:00+00:00 21 MB 
[TXT]The Funny Side of English A Read-n-Laugh Manual to the English Language2012-09-16T01:11:00+00:00 25 MB 
[TXT]Glimpses of Sikh Religion2012-09-16T22:30:00+00:00 24 MB 
[TXT]Inflation Accounting Practices in India's Corporate Sector2012-09-17T19:49:00+00:00 20 MB 
[TXT]Traditional Self-Governing Institutions Among the Hill Tribes of North - East India 1st Edition2012-09-18T17:08:00+00:00 20 MB 
[TXT]Path-Integral Methods and their Applications 1st Indian Reprint2012-09-19T14:27:00+00:00 21 MB 
[TXT]Congress-Muslim League Tussle - 1937-40 A Critical Analysis 1st Edition2012-09-20T11:46:00+00:00 17 MB 
[TXT]Constitutional Safeguards for Scheduled Caste and Scheduled Tribes 1st Edition2012-09-21T09:05:00+00:00 22 MB 
[TXT]Development Communication and Information Economics in the New Millennium2012-09-22T06:24:00+00:00 19 MB 
[TXT]When the Vulture Descends2012-09-23T03:43:00+00:00 24 MB 
[TXT]Yoga Pushpanjali A Treatise on Astrological Combinations 1st Edition2012-09-24T01:02:00+00:00 25 MB 
[TXT]Money Laundering An Insight into the Dark World of Financial Frauds 1st Edition2012-09-24T22:21:00+00:00 22 MB 
[TXT]An Introduction to Eastern Ways of Thinking 1st Edition2012-09-25T19:40:00+00:00 21 MB 
[TXT]Religion and Philosophy for Modern Youth2012-09-26T16:59:00+00:00 25 MB 
[TXT]Rural-Urban Divide Changing Spatial Pattern of Social Variables 1st Edition2012-09-27T14:18:00+00:00 19 MB 
[TXT]Transformation of India as a Knowledge Superpower Strategies for Action 1st Edition2012-09-28T11:37:00+00:00 19 MB 
[TXT]A Treatise on Hydromechanics2012-09-29T08:56:00+00:00 24 MB 
[TXT]Abandoned and Betrayed Afghan Refugees Under UNHCR Protection in New Delhi2012-09-30T06:15:00+00:00 25 MB 
[TXT]Arpan2012-10-01T03:34:00+00:00 23 MB 
[TXT]Consumer Protection and Redressal Machinery in India 1st Edition2012-10-02T00:53:00+00:00 21 MB 
[TXT]Tribal Welfare and Development Emerging Role of Anthropological Explorations 1st Edition2012-10-02T22:12:00+00:00 21 MB 
[TXT]Principles and Practices of Therapeutic Massage 1st Edition2012-10-03T19:31:00+00:00 18 MB 
[TXT]Downfall of Mughal Empire 1st Edition2012-10-04T16:50:00+00:00 25 MB 
[TXT]Indigo Dictionary of Business The Most Comprehensive, Authoritative, and up-to-date Work Available,2012-10-05T14:09:00+00:00 23 MB 
[TXT]Islamic Aadaab2012-10-06T11:28:00+00:00 25 MB 
[TXT]Differential Calculus 1st Edition2012-10-07T08:47:00+00:00 22 MB 
[TXT]The Home and the World2012-10-08T06:06:00+00:00 23 MB 
[TXT]Bobby Blues2012-10-09T03:25:00+00:00 17 MB 
[TXT]Tales of the Poles2012-10-10T00:44:00+00:00 25 MB 
[TXT]50 Aesop's Fables2012-10-10T22:03:00+00:00 23 MB 
[TXT]Summary Proceedings of the First ICRISAT Regional Groundnut Meeting for West Africa, 13-16 Sep 1988,2012-10-11T19:22:00+00:00 18 MB 
[TXT]Duty Drawback - 2003-042012-10-12T16:41:00+00:00 20 MB 
[TXT]Panchayati Raj in India Theory and Practice 1st Edition2012-10-13T14:00:00+00:00 19 MB 
[TXT]How to Really Love Your Husband2012-10-14T11:19:00+00:00 24 MB 
[TXT]Religions of the Hindus Essays and Lectures2012-10-15T08:38:00+00:00 18 MB 
[TXT]Juma ke Khutbe Collections of Sacred Congregational Sermons Delivered on Eve of Fridays and Eidain I2012-10-16T05:57:00+00:00 17 MB 
[TXT]Presidents Speak to the Nation Republic Day Speeches, 1950-20002012-10-17T03:16:00+00:00 21 MB 
[TXT]Presidential Addresses on Arab-Islamic Studies2012-10-18T00:35:00+00:00 23 MB 
[TXT]Life and Work of Muhammad Jalal-Ud-Din Rumi2012-10-18T21:54:00+00:00 24 MB 
[TXT]Internet Technologies2012-10-19T19:13:00+00:00 17 MB 
[TXT]Alternatives in Agriculture Punjab2012-10-20T16:32:00+00:00 18 MB 
[TXT]Local Environment and Lived Experience The Mountain Women of Himachal Pradesh 1st Edition2012-10-21T13:51:00+00:00 24 MB 
[TXT]Secular Gods Blame Hindu Demons The Sangh Parivar Through the Mirror of Distortion 1st Edition2012-10-22T11:10:00+00:00 24 MB 
[TXT]Work Education2012-10-23T08:29:00+00:00 23 MB 
[TXT]Marine Ecosystems 1st Edition2012-10-24T05:48:00+00:00 19 MB 
[TXT]Contemporary Education 1st Edition2012-10-25T03:07:00+00:00 19 MB 
[TXT]Asia-Pacific Security, Globalisation, and Development2012-10-26T00:26:00+00:00 25 MB 
[TXT]Early Brahmanical Cults and Associated Iconography c. 400 B.C. to A.D. 6002012-10-26T21:45:00+00:00 25 MB 
[TXT]Mahrattas, Sikhs and Southern Sultans of India Their Fight Against Foreign Power Reprint Edition2012-10-27T19:04:00+00:00 19 MB 
[TXT]Justice System and Mutinies in British India Reprint Edition2012-10-28T16:23:00+00:00 18 MB 
[TXT]Akshay Kumar Dutta2012-10-29T13:42:00+00:00 18 MB 
[TXT]Bankimchandra Chatterjee Bengali Novelist Reprint2012-10-30T11:01:00+00:00 18 MB 
[TXT]Pandit Atambapu Sharma Manipuri Writer2012-10-31T08:20:00+00:00 17 MB 
[TXT]A Home at Last2012-11-01T05:39:00+00:00 18 MB 
[TXT]The Islamic Art of Persia 1st Published2012-11-02T02:58:00+00:00 21 MB 
[TXT]Kargil The Tables Turned2012-11-03T00:17:00+00:00 19 MB 
[TXT]A Simple Guide to Muslim Prayers2012-11-03T21:36:00+00:00 20 MB 
[TXT]Some Aspects of Jainism in Eastern India 1st Edition2012-11-04T18:55:00+00:00 23 MB 
[TXT]The Sikh Gurus and the Sikh Religion 1st Edition2012-11-05T16:14:00+00:00 20 MB 
[TXT]Nyayabhasyavarttika of Bharadvaja Uddyotakara, Vol. 3 1st Edition2012-11-06T13:33:00+00:00 18 MB 
[TXT]Antiquities of Northern Tibet Pre-Buddhist Archaeological Discoveries on the High Plateau (Findings2012-11-07T10:52:00+00:00 18 MB 
[TXT]Nepal An Exotic Tourist Destination 1st Edition2012-11-08T08:11:00+00:00 17 MB 
[TXT]Financial Analysis2012-11-09T05:30:00+00:00 24 MB 
[TXT]The Fiction of Bharati Mukherjee A Cultural Perspective 1st Edition2012-11-10T02:49:00+00:00 22 MB 
[TXT]English Vocabulary 1st Edition2012-11-11T00:08:00+00:00 18 MB 
[TXT]Orient Book of Quotations2012-11-11T21:27:00+00:00 25 MB 
[TXT]Writing Effectively2012-11-12T18:46:00+00:00 21 MB 
[TXT]World's Greatest Puzzles2012-11-13T16:05:00+00:00 19 MB 
[TXT]More Sherlock Holmes Puzzles 3rd Printing2012-11-14T13:24:00+00:00 18 MB 
[TXT]Ethics Management 1st Edition2012-11-15T10:43:00+00:00 20 MB 
[TXT]Medical Geography of Indian Tribes 1st Edition2012-11-16T08:02:00+00:00 24 MB 
[TXT]Migration in the Third World - 1954-1994 Views and Reviews 1st Edition2012-11-17T05:21:00+00:00 18 MB 
[TXT]Basics of Programming and OOPs Concept2012-11-18T02:40:00+00:00 17 MB 
[TXT]Daughters of the Earth Women and Land in Uttar Pradesh2012-11-18T23:59:00+00:00 23 MB 
[TXT]Lahore - 1947 2nd Edition2012-11-19T21:18:00+00:00 18 MB 
[TXT]Educational Psychology An Introducation 1st Edition2012-11-20T18:37:00+00:00 21 MB 
[TXT]Effective Professional Management 1st Edition2012-11-21T15:56:00+00:00 19 MB 
[TXT]Fundamentals of Modern Physics2012-11-22T13:15:00+00:00 23 MB 
[TXT]Information Technology Management in Libraries 1st Edition2012-11-23T10:34:00+00:00 21 MB 
[TXT]Systems and Practices of Effective Library2012-11-24T07:53:00+00:00 23 MB 
[TXT]Distance Education Challenge and Response 1st Edition2012-11-25T05:12:00+00:00 20 MB 
[TXT]Quality Education 1st Edition2012-11-26T02:31:00+00:00 21 MB 
[TXT]Mantrasara (The Essential Matins)2012-11-26T23:50:00+00:00 23 MB 
[TXT]Construction Innovation and Process Improvement2012-11-27T21:09:00+00:00 24 MB 
[TXT]Deadly Legacy2012-11-28T18:28:00+00:00 21 MB 
[TXT]Sediments, Morphology And Sedimentary Processes On Continental Shelves Advances In Technologies, Res2012-11-29T15:47:00+00:00 17 MB 
[TXT]Injuries of Knee and Leg2012-11-30T13:06:00+00:00 18 MB 
[TXT]Plantwide Control Recent Developments and Applications2012-12-01T10:25:00+00:00 24 MB 
[TXT]Managing with Plans and Budgets in Health and Social Care2012-12-02T07:44:00+00:00 25 MB 
[TXT]Ethnic Business: Chinese Capitalism in Southeast Asia2012-12-03T05:03:00+00:00 18 MB 
[TXT]Biology Question Bank2012-12-04T02:22:00+00:00 23 MB 
[TXT]Training for Leadership 2nd Impression2012-12-04T23:41:00+00:00 19 MB 
[TXT]Religious Concept of Sin 1st Edition2012-12-05T21:00:00+00:00 25 MB 
[TXT]Cognitive Development of Culturally Deprived Children 1st Edition2012-12-06T18:19:00+00:00 21 MB 
[TXT]Time and Work2012-12-07T15:38:00+00:00 21 MB 
[TXT]The Commonsense on the War on Iraq2012-12-08T12:57:00+00:00 22 MB 
[TXT]Manual of Laboratory Procedures for Quality Evaluation of Sorghum and Pearl Millet2012-12-09T10:16:00+00:00 21 MB 
[TXT]Proceedings of the International Pearl Millet Workshop, 7-11 April 1986, ICRISAT Center, India2012-12-10T07:35:00+00:00 19 MB 
[TXT]The (Un) Common Sense of Advertising Getting the Basics Rights 3rd Printing2012-12-11T04:54:00+00:00 17 MB 
[TXT]Socio-Economic Development of Indian Tribes 1st Edition2012-12-12T02:13:00+00:00 24 MB 
[TXT]Dictionary of Subject Titles 1st Edition2012-12-12T23:32:00+00:00 19 MB 
[TXT]Upanished The Real Truth2012-12-13T20:51:00+00:00 24 MB 
[TXT]Playing Field Measurement Manual2012-12-14T18:10:00+00:00 19 MB 
[TXT]A-Z Illustrated Encyclopaedia of Science and Technology2012-12-15T15:29:00+00:00 21 MB 
[TXT]Badminton Skills and Rules2012-12-16T12:48:00+00:00 18 MB 
[TXT]Art and Architecture Remains in the Western Terai Region of Nepal2012-12-17T10:07:00+00:00 22 MB 
[TXT]Defending the Earth A Way of Life - A Handbook for Earthkeeping Reprint2012-12-18T07:26:00+00:00 17 MB 
[TXT]Penumbra Life Coming Out of the Shadows : A Novel2012-12-19T04:45:00+00:00 18 MB 
[TXT]Jeroboam II The King and Amos the Prophet : A Social-Scientific Study on the Israelite Society durin2012-12-20T02:04:00+00:00 17 MB 
[TXT]Masters or Stewards A Theological Reflection on Ecology and Environment2012-12-20T23:23:00+00:00 22 MB 
[TXT]Networking of Universities, Research Institutions and Industry2012-12-21T20:42:00+00:00 17 MB 
[TXT]Understanding Major Pains Headaches, Migraines, Arthritis, Backbone Pain, Angina and a Host of Abdom2012-12-22T18:01:00+00:00 19 MB 
[TXT]Marching Ahead with Science Science and Technology in India since Independence 1st Edition2012-12-23T15:20:00+00:00 19 MB 
[TXT]The Indian Empire Its People, History and Products : Indian vernaculars and their Literature (pp 3252012-12-24T12:39:00+00:00 20 MB 
[TXT]Settlements in the Yamuna-Hindon Doab An Archaeological Perspective 1st Edition2012-12-25T09:58:00+00:00 20 MB 
[TXT]A Study of Hinduism2012-12-26T07:17:00+00:00 18 MB 
[TXT]Career in Insurance2012-12-27T04:36:00+00:00 19 MB 
[TXT]Play and Learn Swimming2012-12-28T01:55:00+00:00 24 MB 
[TXT]Play and Learn Table Tennis2012-12-28T23:14:00+00:00 24 MB 
[TXT]Supreme Court Minority Educational Institutions Cases : T.M.A. Pai Foundation Vs. State of Karnataka2012-12-29T20:33:00+00:00 25 MB 
[TXT]A Critical History of the English Muse2012-12-30T17:52:00+00:00 21 MB 
[TXT]Genetics 1st Edition2012-12-31T15:11:00+00:00 23 MB 
[TXT]Geometry in Ancient India2013-01-01T12:30:00+00:00 21 MB 
[TXT]Valuation of Perquisites Under Income Tax Act2013-01-02T09:49:00+00:00 21 MB 
[TXT]Advanced Readings in Comparative Government and Politics Issues and Challenges 3 Vols. 2nd Revised E2013-01-03T07:08:00+00:00 19 MB 
[TXT]Alienation An Existentialist Concept2013-01-04T04:27:00+00:00 21 MB 
[TXT]All India National Congress 4 Vols. 1st Edition2013-01-05T01:46:00+00:00 25 MB 
[TXT]Antiquity to Modernity in Tribal India 4 Vols. 1st Edition2013-01-05T23:05:00+00:00 19 MB 
[TXT]Bank Lending Law and Practice2013-01-06T20:24:00+00:00 24 MB 
[TXT]Advances in Fish and Wildlife Ecology and Biology Vol. 22013-01-07T17:43:00+00:00 23 MB 
[TXT]Committees and Commissions in Pre-Independence India : 1897-1902 Vol. 3 1st Edition2013-01-08T15:02:00+00:00 21 MB 
[TXT]Financial Management Theory & Practice2013-01-09T12:21:00+00:00 17 MB 
[TXT]Economyths How the Science of Complex Systems Is Transforming Economic Thought Illustrated Edition2013-01-10T09:40:00+00:00 21 MB 
[TXT]Civil Engineering Project Management2013-01-11T06:59:00+00:00 20 MB 
[TXT]Dermatology & Venereology Pre Pg Test Review2013-01-12T04:18:00+00:00 24 MB 
[TXT]Hip-Hop Nature Boy and Other Poems2013-01-13T01:37:00+00:00 25 MB 
[TXT]Race, Racial Attitudes and Stratification Beliefs2013-01-13T22:56:00+00:00 17 MB 
[TXT]Who Was Steve Jobs? Who Was...?2013-01-14T20:15:00+00:00 17 MB 
[TXT]An Introduction To Medicinal Chemistry2013-01-15T17:34:00+00:00 25 MB 
[TXT]Comprehensive Dermatologic Drug Therapy2013-01-16T14:53:00+00:00 19 MB 
[TXT]Complete Green Series Bundle The Sage Reference Series on Green Society2013-01-17T12:12:00+00:00 22 MB 
[TXT]The International Student's Survival Guide How to Get the Most from Studying at2013-01-18T09:31:00+00:00 24 MB 
[TXT]Ultimate Music Variety CD2013-01-19T06:50:00+00:00 24 MB 
[TXT]Maths Made Easy Key Stage 2 Advance2013-01-20T04:09:00+00:00 25 MB 
[TXT]Blotto, Twinks and the Dead Dowager Duchess First Edition2013-01-21T01:28:00+00:00 21 MB 
[TXT]Biopiracy The Plunder of Nature and Knowledge Indian Edition2013-01-21T22:47:00+00:00 20 MB 
[TXT]India's Foreign Policy Nehru to Vajpayee 1st Edition2013-01-22T20:06:00+00:00 17 MB 
[TXT]Modern Americal Literature2013-01-23T17:25:00+00:00 22 MB 
[TXT]Phytohormones in Crop Productivity Under Different Environments 1st Edition2013-01-24T14:44:00+00:00 17 MB 
[TXT]Ethnoarchaeology in Action 1st Published2013-01-25T12:03:00+00:00 24 MB 
[TXT]Intercultural Communication An Agenda for Developing Countries2013-01-26T09:22:00+00:00 23 MB 
[TXT]Future Library Technology 1st Edition2013-01-27T06:41:00+00:00 19 MB 
[TXT]Emerging Issues of Indian Economic Development 1st Edition2013-01-28T04:00:00+00:00 25 MB 
[TXT]Pricing of New Issues in Indian Capital Market2013-01-29T01:19:00+00:00 19 MB 
[TXT]Effective Personnel Management 1st Edition2013-01-29T22:38:00+00:00 24 MB 
[TXT]Environment and Agricultural Pollution 1st Edition2013-01-30T19:57:00+00:00 17 MB 
[TXT]Parties Elections and Mobilisation2013-01-31T17:16:00+00:00 17 MB 
[TXT]Red Light Area Social Environment of Sex Workers 1st Edition2013-02-01T14:35:00+00:00 22 MB 
[TXT]Business Finance2013-02-02T11:54:00+00:00 22 MB 
[TXT]Cleaner Air and Better Transport Making Informed Choices2013-02-03T09:13:00+00:00 24 MB 
[TXT]A Tree in my Village2013-02-04T06:32:00+00:00 25 MB 
[TXT]Islamic World Inter-State Relations 1st Edition2013-02-05T03:51:00+00:00 21 MB 
[TXT]World Conference on Education for All 1st Edition2013-02-06T01:10:00+00:00 17 MB 
[TXT]Twist of Truth 1st Edition2013-02-06T22:29:00+00:00 23 MB 
[TXT]Video Acquisitions and Cataloguing 1st Edition2013-02-07T19:48:00+00:00 19 MB 
[TXT]Taxation and Corporate Dividend Behaviour in India2013-02-08T17:07:00+00:00 21 MB 
[TXT]Biochemistry The Practice Portfolio of Latest Questions2013-02-09T14:26:00+00:00 17 MB 
[TXT]D.P. Mishra The Man and His Ideology2013-02-10T11:45:00+00:00 22 MB 
[TXT]Dangers of Information Technology Emerging Threats to Individual Privacy 1st Edition2013-02-11T09:04:00+00:00 22 MB 
[TXT]A Primer of Literary Criticism 1st Edition2013-02-12T06:23:00+00:00 17 MB 
[TXT]Praxis Oriented Lent2013-02-13T03:42:00+00:00 24 MB 
[TXT]Go and Make Disciples 2nd Reprint2013-02-14T01:01:00+00:00 19 MB 
[TXT]A Guide to Jeremiah 2nd Reprint2013-02-14T22:20:00+00:00 24 MB 
[TXT]Plights in Prison2013-02-15T19:39:00+00:00 24 MB 
[TXT]Shelter for All2013-02-16T16:58:00+00:00 25 MB 
[TXT]Dangerous : Drugs Drinks and Tobacco2013-02-17T14:17:00+00:00 19 MB 
[TXT]Active Society and Behavioural Therapy 1st Edition2013-02-18T11:36:00+00:00 20 MB 
[TXT]Entrepreneurship Development in India 1st Edition2013-02-19T08:55:00+00:00 19 MB 
[TXT]Administrative Discretion and Judicial Review 1st Edition2013-02-20T06:14:00+00:00 24 MB 
[TXT]Selected Doctrines from Indian Philosophy 1st Edition2013-02-21T03:33:00+00:00 17 MB 
[TXT]A Textbook of Helminthes2013-02-22T00:52:00+00:00 24 MB 
[TXT]International Money and Finance An Analysis of New Global Architecture2013-02-22T22:11:00+00:00 23 MB 
[TXT]Marketing Channel Management A Customer-Centric Approach 14th Printing2013-02-23T19:30:00+00:00 19 MB 
[TXT]All You Wanted to Know About Diarrhoea2013-02-24T16:49:00+00:00 17 MB 
[TXT]Essence of Buddhism A Collection of World Famous Quotations 1st Edition2013-02-25T14:08:00+00:00 23 MB 
[TXT]Research Priorities in North-East India With Special Reference in Manipur2013-02-26T11:27:00+00:00 23 MB 
[TXT]Sarup Dictionary of Difficult Words 1st Edition2013-02-27T08:46:00+00:00 21 MB 
[TXT]Geography of a Himalayan Kingdom : Bhutan 1st Published2013-02-28T06:05:00+00:00 24 MB 
[TXT]Guwahati : The Gateway to the East2013-03-01T03:24:00+00:00 25 MB 
[TXT]Play Better Cricket2013-03-02T00:43:00+00:00 24 MB 
[TXT]Play Better Diving2013-03-02T22:02:00+00:00 19 MB 
[TXT]Bitter to Better Harvest Post Green Revolution : Agricultural and Marketing Strategy for India 1st E2013-03-03T19:21:00+00:00 20 MB 
[TXT]Population-Health Literacy Concept, Content and Communication 1st Edition2013-03-04T16:40:00+00:00 19 MB 
[TXT]Social Development 1st Published2013-03-05T13:59:00+00:00 20 MB 
[TXT]Working Capital Management : A Comparative Study 1st Edition2013-03-06T11:18:00+00:00 20 MB 
[TXT]Population Education 1st Edition2013-03-07T08:37:00+00:00 25 MB 
[TXT]Staff Management and Information Work 1st Edition2013-03-08T05:56:00+00:00 17 MB 
[TXT]A-Z Handbook of Health Education and Sports : Muscles of the Abdomen and Thorax2013-03-09T03:15:00+00:00 20 MB 
[TXT]Jahangir's India The Remonstrantie of Francisco Pelsaert Reprint2013-03-10T00:34:00+00:00 20 MB 
[TXT]Role of Panchayati Raj Institutions for Rural Development 1st Edition2013-03-10T21:53:00+00:00 22 MB 
[TXT]Textbook of Psychology2013-03-11T19:12:00+00:00 24 MB 
[TXT]Tribes of Car Nicobar2013-03-12T16:31:00+00:00 17 MB 
[TXT]Roots of Confrontation in South Asia2013-03-13T13:50:00+00:00 23 MB 
[TXT]Education in Information Age 1st Edition2013-03-14T11:09:00+00:00 22 MB 
[TXT]Role of Computers in Library Science 1st Edition2013-03-15T08:28:00+00:00 20 MB 
[TXT]Subject Analysis in Online Cataloging 1st Edition2013-03-16T05:47:00+00:00 19 MB 
[TXT]Indian Economy Reflections from the First Decade of Reforms 1st Edition2013-03-17T03:06:00+00:00 18 MB 
[TXT]Manual of Laboratory Specimens-Chordates2013-03-18T00:25:00+00:00 20 MB 
[TXT]Information Technology and Total Quality Management2013-03-18T21:44:00+00:00 18 MB 
[TXT]William Shakespeare King Richard-II2013-03-19T19:03:00+00:00 18 MB 
[TXT]Joint Forest Management in Assam2013-03-20T16:22:00+00:00 18 MB 
[TXT]Philosophical Psychology of Soul Mechanism Oriental and Occidental Studies 1st Edition2013-03-21T13:41:00+00:00 19 MB 
[TXT]Rajasthan's Silver Jewellery A Living Legacy 1st Edition2013-03-22T11:00:00+00:00 18 MB 
[TXT]Orthopaedic Manifestations and Bone Changes in Sickle Cell Haemoglobinopathy2013-03-23T08:19:00+00:00 20 MB 
[TXT]El Despido Interior En La Pareja Que Nos Ha Ocurrido?2013-03-24T05:38:00+00:00 24 MB 
[TXT]Encyclopaedia of Cooperative Management 5 Vols.2013-03-25T02:57:00+00:00 21 MB 
[TXT]A Pali Reader - With Notes and Glossary (Text and Notes) Vol. 1 2nd Reprint Copenhagen 1901 Edition2013-03-26T00:16:00+00:00 20 MB 
[TXT]Ancient Indian Heritage Varahamihira's Indi2013-03-26T21:35:00+00:00 22 MB 
[TXT]Anthropology of Development Commemoration Volume in the Honour of Professor I.P. Singh 1st Edition2013-03-27T18:54:00+00:00 25 MB 
[TXT]Buddhist Essays - I Five Titles2013-03-28T16:13:00+00:00 17 MB 
[TXT]Encyclopaedic Dictionary of Marketing 2 Vols. 1st Edition2013-03-29T13:32:00+00:00 23 MB 
[TXT]Encyclopaedic Dictionary of Religion and Ethics 3 Vols. 1st Edition2013-03-30T10:51:00+00:00 19 MB 
[TXT]Heterosis and Hybrid Seed Production in Agronomic Crops2013-03-31T08:10:00+00:00 24 MB 
[TXT]Contemporary American-Jewish Novel 2 Vols. 1st Edition2013-04-01T05:29:00+00:00 24 MB 
[TXT]Contemporary Sources of the Mediaeval and Modern History of Bundelkhand - 1531-1857 Panna Records 162013-04-02T02:48:00+00:00 19 MB 
[TXT]Census of Agriculture - 2002 Sri Lanka (Small Holding Sector) : Anuradhapura District Preliminary Re2013-04-03T00:07:00+00:00 25 MB 
[TXT]Demographic and Health Survey Sri Lanka, 2000 Preliminary Report 1st Print2013-04-03T21:26:00+00:00 21 MB 
[TXT]Agricultural Crops and Livestock, 1992/93 Colombo District : Preliminary Report2013-04-04T18:45:00+00:00 17 MB 
[TXT]Among My Souvenirs A Novel2013-04-05T16:04:00+00:00 18 MB 
[TXT]Sometimes there is no Blood Domestic Violence and Rape in Rural Sri Lanka - Report2013-04-06T13:23:00+00:00 18 MB 
[TXT]Encyclopedia of Strategic Management2013-04-07T10:42:00+00:00 19 MB 
[TXT]The English Works of Raja Rammohan Roy With an English Translation of Tuhfatul Muwahhiddin 4 Vols.2013-04-08T08:01:00+00:00 24 MB 
[TXT]Weekly Retail Prices Colombo City January 2000 - December 20002013-04-09T05:20:00+00:00 18 MB 
[TXT]Fury A Novel2013-04-10T02:39:00+00:00 22 MB 
[TXT]History of Bagree-Rajya (Garhbeta) With Special Reference to its Anti-British Role, from Late 18th C2013-04-10T23:58:00+00:00 23 MB 
[TXT]Political Orientation of People in Rural India A Study of Bihar With Reference to Antecedents and C2013-04-11T21:17:00+00:00 25 MB 
[TXT]The Socio-Cultural World of Women in Medieval Andhra From 11th to 13th Centuries A.D.2013-04-12T18:36:00+00:00 24 MB 
[TXT]Weekly Retail Prices Colombo City January 1995 - December 19952013-04-13T15:55:00+00:00 23 MB 
[TXT]Census of Agriculture, 2002, Sri Lanka Small Holding Sector : Puttalam District - Preliminary Report2013-04-14T13:14:00+00:00 17 MB 
[TXT]Ethnographic Notes on Southern India2013-04-15T10:33:00+00:00 21 MB 
[TXT]Living Experiences of Enlightenment2013-04-16T07:52:00+00:00 23 MB 
[TXT]Geology of the Country Around - Polonnaruwa Reprint2013-04-17T05:11:00+00:00 18 MB 
[TXT]Defence Expenditure in South Asia An Overview 1st Edition2013-04-18T02:30:00+00:00 21 MB 
[TXT]Women in the Informal Sector2013-04-18T23:49:00+00:00 19 MB 
[TXT]Life Under Milk Wood Women Workers in Rubber Plantations : An Overview2013-04-19T21:08:00+00:00 24 MB 
[TXT]Excursions, Adventures, and Field-sports in Ceylon, its Commercial and Military Importance2013-04-20T18:27:00+00:00 25 MB 
[TXT]Gender and Society Some Contemporary Issues2013-04-21T15:46:00+00:00 22 MB 
[TXT]Post Beijing Reflections Women in Sri Lanka, 1995-2000 1st Edition2013-04-22T13:05:00+00:00 20 MB 
[TXT]A Compendium of Indian Weed Science Research, 1950-19812013-04-23T10:24:00+00:00 17 MB 
[TXT]The Hybrid Island Culture Crossings and the Invention of Identity in Sri Lanka2013-04-24T07:43:00+00:00 25 MB 
[TXT]Fazail-E-Amaal Vol. 12013-04-25T05:02:00+00:00 24 MB 
[TXT]Encyclopaedia of Chemistry2013-04-26T02:21:00+00:00 23 MB 
[TXT]Encyclopaedia of Child Care Welfare and Guidance 2 Vols. 1st Edition2013-04-26T23:40:00+00:00 19 MB 
[TXT]History of the Parsis Including Their Manners, Customs, Religion and Present Position 2 Vols. 1st Ed2013-04-27T20:59:00+00:00 22 MB 
[TXT]History of the Rise of the Mahomedan Power in India Vol. 22013-04-28T18:18:00+00:00 17 MB 
[TXT]Encyclopaedia of Computer Software Technology 3 Vols. 1st Edition2013-04-29T15:37:00+00:00 20 MB 
[TXT]Diagnosis and Treatment of Diseases in Ayurveda Based on Ayurveda Saukhyam of Todarananda Part 2 Rep2013-04-30T12:56:00+00:00 18 MB 
[TXT]Encyclopaedia of Economic Planning and Development 5 Vols. 1st Edition2013-05-01T10:15:00+00:00 17 MB 
[TXT]Dalits in India 2 Vols. 1st Edition2013-05-02T07:34:00+00:00 25 MB 
[TXT]Principles and Perspectives Vol. 12013-05-03T04:53:00+00:00 19 MB 
[TXT]Cash Crops Vol. 62013-05-04T02:12:00+00:00 19 MB 
[TXT]French in India and Indian Nationalism, 1700 A.D.-1963 A.D. Vol. 22013-05-04T23:31:00+00:00 24 MB 
[TXT]Illustrated Encyclopaedia of World Knowledge2013-05-05T20:50:00+00:00 18 MB 
[TXT]Quarterly Report of the Sri Lanka Labour Force Survey Third Quarter, 19992013-05-06T18:09:00+00:00 25 MB 
[TXT]Encyclopaedia of Health and Nutrition2013-05-07T15:28:00+00:00 19 MB 
[TXT]The Lion's Roar Two Discourses of the Buddha from the Majjhima Nika2013-05-08T12:47:00+00:00 19 MB 
[TXT]India-Bangladesh Relations Documents - 1971-2002 Vol. 12013-05-09T10:06:00+00:00 25 MB 
[TXT]C.W. Thamotharampillai, Tamil Revivalist : The Man Behind the Legend of Tamil Nationalism An Interna2013-05-10T07:25:00+00:00 25 MB 
[TXT]Illustrated Dravyaguna Vijnana 5 Vols.2013-05-11T04:44:00+00:00 18 MB 
[TXT]Manual of Geology 2 Vols. Reprint2013-05-12T02:03:00+00:00 23 MB 
[TXT]Indian Geomorphology2013-05-12T23:22:00+00:00 18 MB 
[TXT]Agricultural Crops and Livestock, 1993/94 Anuradhapura District - Preliminary Report2013-05-13T20:41:00+00:00 24 MB 
[TXT]Economic Geography of the World2013-05-14T18:00:00+00:00 22 MB 
[TXT]Indian Writings on Education, 1979 to 1986 An Indicator to Indian Educational Journals Grouped by 22013-05-15T15:19:00+00:00 19 MB 
[TXT]Modern Technology of Agro Processing and Agricultural Waste Products 1st Edition2013-05-16T12:38:00+00:00 25 MB 
[TXT]Indian Philosophy Vol. 3 Reprint2013-05-17T09:57:00+00:00 17 MB 
[TXT]Globalization and the Transformation of Planetary Rituals in Southern Sri Lanka2013-05-18T07:16:00+00:00 21 MB 
[TXT]Indian Writings in English Vol. 82013-05-19T04:35:00+00:00 22 MB 
[TXT]Introducing Buddhism2013-05-20T01:54:00+00:00 24 MB 
[TXT]Encyclopaedia of Investment Management 2 Vols. 1st Edition2013-05-20T23:13:00+00:00 20 MB 
[TXT]Effective Collective Bargaining 2 Vols. 1st Edition2013-05-21T20:32:00+00:00 19 MB 
[TXT]Encyclopaedia of Library and Information Technology for 21st Century 50 Vols. 1st Edition2013-05-22T17:51:00+00:00 17 MB 
[TXT]Kannada Vol. 4 1st Published2013-05-23T15:10:00+00:00 22 MB 
[TXT]Notes on the Great Indian Circus2013-05-24T12:29:00+00:00 17 MB 
[TXT]Srngaraprakasa2013-05-25T09:48:00+00:00 17 MB 
[TXT]Environmental Controversies2013-05-26T07:07:00+00:00 24 MB 
[TXT]Martial Discord in Indian English Novel An Indepth Study of Major Contemporary Indian Novelists in E2013-05-27T04:26:00+00:00 22 MB 
[TXT]Osama Bin Laden The Patron Saint of Terrorism2013-05-28T01:45:00+00:00 20 MB 
[TXT]Ashab Al Kahf The Stunning Story of the Sleepers2013-05-28T23:04:00+00:00 21 MB 
[TXT]Community and Identities Contemporary Discourses on Culture and Politics in India 1st Published2013-05-29T20:23:00+00:00 21 MB 
[TXT]Agrarian System in Medieval India Land Revenue Arrangements in Sarkar Shahabad (Bihar), 1734-17902013-05-30T17:42:00+00:00 21 MB 
[TXT]2001 Census as Social Document 1st Edition2013-05-31T15:01:00+00:00 25 MB 
[TXT]Atomic Energy and India's Nuclear Capability2013-06-01T12:20:00+00:00 21 MB 
[TXT]Designing and Developing Organisations for Tomorrow 1st Published2013-06-02T09:39:00+00:00 22 MB 
[TXT]Development Administration in an Indian State Guide Book Evolved for BDO in Orissa2013-06-03T06:58:00+00:00 24 MB 
[TXT]Environmental Implications of Farmland Diversification 1st Edition2013-06-04T04:17:00+00:00 21 MB 
[TXT]Bus Transport in India The Structure, Management and Performance of Road Transport Corporation2013-06-05T01:36:00+00:00 22 MB 
[TXT]Come Evening : Carry Me Away (Poetry)2013-06-05T22:55:00+00:00 22 MB 
[TXT]Dynamics of Public Enterprise Management2013-06-06T20:14:00+00:00 23 MB 
[TXT]Ecological Problems of Developing Countries2013-06-07T17:33:00+00:00 20 MB 
[TXT]An Essay on the Myth of the Rbhus 1st Edition2013-06-08T14:52:00+00:00 23 MB 
[TXT]Industrial Exports and Developing Countries India Search for Countervailing Power2013-06-09T12:11:00+00:00 23 MB 
[TXT]Minority Peoples in the Age of Nations States2013-06-10T09:30:00+00:00 17 MB 
[TXT]Psycho-Analytic Concept of Religion2013-06-11T06:49:00+00:00 22 MB 
[TXT]Regulated Market in a Rural Economy2013-06-12T04:08:00+00:00 25 MB 
[TXT]Students, Teachers and Parents Academic Interaction in Education Setting2013-06-13T01:27:00+00:00 18 MB 
[TXT]Submerging Villages Problems and Prospects2013-06-13T22:46:00+00:00 18 MB 
[TXT]Chamba Himalaya Amazing Land, Unique Culture 1st Edition2013-06-14T20:05:00+00:00 18 MB 
[TXT]Marriage Customs & Traditions of the World Reprint2013-06-15T17:24:00+00:00 21 MB 
[TXT]Sai Baba An Encounter2013-06-16T14:43:00+00:00 22 MB 
[TXT]The Company of Nobel Thoughts2013-06-17T12:02:00+00:00 21 MB 
[TXT]Community Participation in Natural Resource Management 1st Edition2013-06-18T09:21:00+00:00 21 MB 
[TXT]The Arab-Israeli Wars Indian Edition2013-06-19T06:40:00+00:00 21 MB 
[TXT]Muslim Educational Thought in the Middle Ages2013-06-20T03:59:00+00:00 21 MB 
[TXT]Raising Additional Resources in the States2013-06-21T01:18:00+00:00 22 MB 
[TXT]Political Philosophy of the Sikh Gurus2013-06-21T22:37:00+00:00 20 MB 
[TXT]Anthropology2013-06-22T19:56:00+00:00 18 MB 
[TXT]Comparative Politics 2nd Revised & Enlarged Edition2013-06-23T17:15:00+00:00 17 MB 
[TXT]The Plays of Eugene ONeill A Critical Study2013-06-24T14:34:00+00:00 19 MB 
[TXT]Iqbal and the English Romantics2013-06-25T11:53:00+00:00 23 MB 
[TXT]History of Ancient India Earliest Times to 1200 A.D.2013-06-26T09:12:00+00:00 19 MB 
[TXT]Handbook of International Sources on Reference and Information 1st Edition2013-06-27T06:31:00+00:00 23 MB 
[TXT]A Classical Dictionary of India2013-06-28T03:50:00+00:00 23 MB 
[TXT]Write for Mathematics 2nd Edition2013-06-29T01:09:00+00:00 20 MB 
[TXT]Outside the Circle A Video Story with Activities to Combat Racism and Prejudice for Young People Ag2013-06-29T22:28:00+00:00 22 MB 
[TXT]Pragmatism 3 Vol. Set2013-06-30T19:47:00+00:00 19 MB 
[TXT]A Practical Approach to Special Education for Every Teacher The 13 Book Collection2013-07-01T17:06:00+00:00 17 MB 
[TXT]B.E.S.T. Buddies A Comprehensive Training Programme Introducing a Peer Buddy System to Support Stude2013-07-02T14:25:00+00:00 18 MB 
[TXT]The Secret Princess2013-07-03T11:44:00+00:00 24 MB 
[TXT]Canyon of Dreams The Magic and the Music of Laurel Canyon Illustrated Edition2013-07-04T09:03:00+00:00 20 MB 
[TXT]Social Work Practice with Children and Families2013-07-05T06:22:00+00:00 19 MB 
[TXT]Gerard Manley Hopkins2013-07-06T03:41:00+00:00 25 MB 
[TXT]Human Rights Christians, Marxists, and Others in Dialogue2013-07-07T01:00:00+00:00 24 MB 
[TXT]One Light Flash2013-07-07T22:19:00+00:00 18 MB 
[TXT]English for Primary and Early Years Developing Subject Knowledge 2nd Edition2013-07-08T19:38:00+00:00 24 MB 
[TXT]Creating Small Scale Social Programs Planning, Implementation, and Evaluation2013-07-09T16:57:00+00:00 21 MB 
[TXT]Chip and Dip Lovers Cookbook2013-07-10T14:16:00+00:00 23 MB 
[TXT]Pero Tafur Travels and Adventures 1435-14392013-07-11T11:35:00+00:00 25 MB 
[TXT]Fundamental Concepts of Inorganic Chemistry, Vol.3 2nd Edition2013-07-12T08:54:00+00:00 22 MB 
[TXT]Writers on Organizations 6th Edition2013-07-13T06:13:00+00:00 20 MB 
[TXT]Do Arrests and Restraining Orders Work?2013-07-14T03:32:00+00:00 23 MB 
[TXT]Special Educational Needs A Guide for Inclusive Practice2013-07-15T00:51:00+00:00 18 MB 
[TXT]The Housing Monster2013-07-15T22:10:00+00:00 22 MB 
[TXT]Quality Improvement in European Public Services Concepts, Cases and Commentary2013-07-16T19:29:00+00:00 18 MB 
[TXT]Applied Cross-Cultural Psychology2013-07-17T16:48:00+00:00 21 MB 
[TXT]Deceptive Communication2013-07-18T14:07:00+00:00 23 MB 
[TXT]The Upgrade2013-07-19T11:26:00+00:00 24 MB 
[TXT]The Plural Self Multiplicity in Everyday Life2013-07-20T08:45:00+00:00 20 MB 
[TXT]Engel : The Practice of Research in Social Work, 3 Editon + Holosko : Pocket Glossary for Commonly2013-07-21T06:04:00+00:00 20 MB 
[TXT]Literature and the American College2013-07-22T03:23:00+00:00 19 MB 
[TXT]Assumptions about Human Nature Implications for Researchers and Practitioners2013-07-23T00:42:00+00:00 24 MB 
[TXT]A World of Giant Cities The Metropolis Era2013-07-23T22:01:00+00:00 20 MB 
[TXT]J3 Crucible of Chaos2013-07-24T19:20:00+00:00 25 MB 
[TXT]Media Literacy 6th Edition2013-07-25T16:39:00+00:00 25 MB 
[TXT]The Catholic Milieu2013-07-26T13:58:00+00:00 17 MB 
[TXT]The New Roget's Thesaurus Student Edition2013-07-27T11:17:00+00:00 21 MB 
[TXT]Here on Earth2013-07-28T08:36:00+00:00 23 MB 
[TXT]Poirot Investigates2013-07-29T05:55:00+00:00 20 MB 
[TXT]Stardust of Yesterday2013-07-30T03:14:00+00:00 18 MB 
[TXT]Hanging By a Thread2013-07-31T00:33:00+00:00 23 MB 
[TXT]Letter from Home 1st edition2013-07-31T21:52:00+00:00 24 MB 
[TXT]Odds Against2013-08-01T19:11:00+00:00 24 MB 
[TXT]Bad Business2013-08-02T16:30:00+00:00 18 MB 
[TXT]The Shadow of the Apocalypse2013-08-03T13:49:00+00:00 22 MB 
[TXT]Delectable Mountains2013-08-04T11:08:00+00:00 21 MB 
[TXT]Gemini2013-08-05T08:27:00+00:00 22 MB 
[TXT]Dont Eat This Book Fast Food and the Supersizing of America2013-08-06T05:46:00+00:00 23 MB 
[TXT]Mysteria2013-08-07T03:05:00+00:00 21 MB 
[TXT]Aging Fight it with the Blood Type Diet2013-08-08T00:24:00+00:00 22 MB 
[TXT]Demon's Delight2013-08-08T21:43:00+00:00 18 MB 
[TXT]The Oxford New Italian Dictionary2013-08-09T19:02:00+00:00 23 MB 
[TXT]Big Girls Dont Cry2013-08-10T16:21:00+00:00 23 MB 
[TXT]Servant The Awakening2013-08-11T13:40:00+00:00 20 MB 
[TXT]Dave Barry's History of the Millenn2013-08-12T10:59:00+00:00 17 MB 
[TXT]Sweet Life2013-08-13T08:18:00+00:00 18 MB 
[TXT]Sea Witch Children of the Sea, Book 12013-08-14T05:37:00+00:00 21 MB 
[TXT]Suite 6062013-08-15T02:56:00+00:00 17 MB 
[TXT]Mona Lisa Blossoming2013-08-16T00:15:00+00:00 22 MB 
[TXT]Seduced at Midnight2013-08-16T21:34:00+00:00 18 MB 
[TXT]Witch Fury2013-08-17T18:53:00+00:00 17 MB 
[TXT]Bone By Bone2013-08-18T16:12:00+00:00 20 MB 
[TXT]Eggs Benedict Arnold2013-08-19T13:31:00+00:00 25 MB 
[TXT]Guilty Until Proven Innocent2013-08-20T10:50:00+00:00 23 MB 
[TXT]The Lost Throne2013-08-21T08:09:00+00:00 23 MB 
[TXT]My Stolen Son: The Nick Markowitz Story2013-08-22T05:28:00+00:00 21 MB 
[TXT]Assassin's Heart2013-08-23T02:47:00+00:00 21 MB 
[TXT]The Judas Child2013-08-24T00:06:00+00:00 25 MB 
[TXT]World-Class Ice Skater2013-08-24T21:25:00+00:00 19 MB 
[TXT]Under Crescent and Cross The Jews in the Middle Ages2013-08-25T18:44:00+00:00 20 MB 
[TXT]The Right Talk How Conservatives Transformed the Great Society into the Economic Society2013-08-26T16:03:00+00:00 25 MB 
[TXT]Mammals of North America 2nd Edition2013-08-27T13:22:00+00:00 25 MB 
[TXT]Hedge Funds An Analytic Perspective2013-08-28T10:41:00+00:00 20 MB 
[TXT]Lili at Ballet (Paperstar Book)2013-08-29T08:00:00+00:00 17 MB 
[TXT]George Washington's Breakfast2013-08-30T05:19:00+00:00 25 MB 
[TXT]And America Attacked Monster of Terrorism in 21st Century 1st Edition2013-08-31T02:38:00+00:00 22 MB 
[TXT]Globalisation and International Finance2013-08-31T23:57:00+00:00 20 MB 
[TXT]Technological Change in Indian Irrigated Agriculture A Study of Water Saving Methods 1st Edition2013-09-01T21:16:00+00:00 20 MB 
[TXT]Tales of the Sun or Folklore of Southern India 1st Edition2013-09-02T18:35:00+00:00 18 MB 
[TXT]Early Buddhism Reprint London 1908 Edition2013-09-03T15:54:00+00:00 23 MB 
[TXT]The Inhabitants of Asia The History of Existing and Extinct Nations, their Ethnology, Manners, and C2013-09-04T13:13:00+00:00 17 MB 
[TXT]Joint Disorders Care in Ayurveda 2nd Edition2013-09-05T10:32:00+00:00 25 MB 
[TXT]Library Database Management 1st Edition2013-09-06T07:51:00+00:00 22 MB 
[TXT]Encyclopaedia of Natural History 6 Vols.2013-09-07T05:10:00+00:00 22 MB 
[TXT]Encyclopaedia of Information and Library Science 10 Vols. 1st Edition2013-09-08T02:29:00+00:00 17 MB 
[TXT]Tribal Cosmology, Myths, and World View Vol. 42013-09-08T23:48:00+00:00 20 MB 
[TXT]Market Regulation and Development2013-09-09T21:07:00+00:00 25 MB 
[TXT]Women Poverty and Family Survival2013-09-10T18:26:00+00:00 24 MB 
[TXT]Encyclopaedia of Animal Diseases 6 Vols. 1st Edition2013-09-11T15:45:00+00:00 23 MB 
[TXT]Encyclopaedia of Applied Psychology 5 Vols. 1st Edition2013-09-12T13:04:00+00:00 23 MB 
[TXT]Waders in Sri Lanka A Guide to Their Indentification and Study 1st Published2013-09-13T10:23:00+00:00 20 MB 
[TXT]Graduate Employment in Sri Lanka in the 1990s2013-09-14T07:42:00+00:00 23 MB 
[TXT]Perspectives on Language in Society : Papers in Memory of Prof. Srivastava 2 Vols.2013-09-15T05:01:00+00:00 24 MB 
[TXT]Sacred Songs of India Vol. 7 1st Edition2013-09-16T02:20:00+00:00 25 MB 
[TXT]Commonsense About Our Environment2013-09-16T23:39:00+00:00 25 MB 
[TXT]Encyclopaedia of Environmental Water Pollution 3 Vols. Reprint2013-09-17T20:58:00+00:00 21 MB 
[TXT]Low Volume Roads Construction and Maintenance A Working Manual 1st Edition2013-09-18T18:17:00+00:00 23 MB 
[TXT]New Directions in Indian Psychology Social Psychology 1st Edition2013-09-19T15:36:00+00:00 23 MB 
[TXT]Encyclopaedia of Sports, Health and Physical Education2013-09-20T12:55:00+00:00 21 MB 
[TXT]Political Science Annual, 1997 Special Volume on India at 502013-09-21T10:14:00+00:00 18 MB 
[TXT]Life Bob Dylan Forever Young2013-09-22T07:33:00+00:00 18 MB 
[TXT]Recruiting and Training Successful Substitute Teachers Participant's Notebook2013-09-23T04:52:00+00:00 18 MB 
[TXT]The Legacy of Longevity Health and Health Care in Later Life2013-09-24T02:11:00+00:00 18 MB 
[TXT]Angels in Vietnam Two Vietnam Novels From2013-09-24T23:30:00+00:00 24 MB 
[TXT]Walsh, Introduction to Criminology : A Text Reader, 2 Edition + Pratt, Key Ideas in Criminology [BU2013-09-25T20:49:00+00:00 20 MB 
[TXT]False Friends2013-09-26T18:08:00+00:00 17 MB 
[TXT]Cumulative Student Activity Record of Clinical Experience for MSC Nursing Program (Log Book) As Per2013-09-27T15:27:00+00:00 20 MB 
[TXT]Social Control and Political Order European Perspectives at the End of the Century2013-09-28T12:46:00+00:00 18 MB 
[TXT]Knowing Feminisms On Academic Borders, Territories and Tribes2013-09-29T10:05:00+00:00 23 MB 
[TXT]Leadership Theory and Practice 6th Edition2013-09-30T07:24:00+00:00 21 MB 
[TXT]Courage to Remember2013-10-01T04:43:00+00:00 18 MB 
[TXT]Jewish Identity in the Postmodern Age2013-10-02T02:02:00+00:00 24 MB 
[TXT]African American Acculturation Deconstructing Race and Reviving Culture2013-10-02T23:21:00+00:00 20 MB 
[TXT]Safe and Effective Gynecological Endoscopic Minimal Access Surgery 1st Edition2013-10-03T20:40:00+00:00 18 MB 
[TXT]Radiology For Undergraduates and General Practitioners 1st Edition2013-10-04T17:59:00+00:00 21 MB 
[TXT]Review in Oral Pathology with MCQs 1st Edition2013-10-05T15:18:00+00:00 25 MB 
[TXT]Bangladesh - US Relations From Cooperation to Partnership 1st Edition2013-10-06T12:37:00+00:00 17 MB 
[TXT]Training for Agriculture and Rural Development - 1997-982013-10-07T09:56:00+00:00 18 MB 
[TXT]Civilization of Love2013-10-08T07:15:00+00:00 19 MB 
[TXT]Strange But True in Sikhism2013-10-09T04:34:00+00:00 20 MB 
[TXT]Yoga for Health Curative Powers of Yogasanas Reprint Edition2013-10-10T01:53:00+00:00 18 MB 
[TXT]Afghanistan Things Fall Apart - A Wordsmiths Compilation 1st Edition2013-10-10T23:12:00+00:00 19 MB 
[TXT]Indian Poetesses From Vedic to Modern Times 1st Edition2013-10-11T20:31:00+00:00 17 MB 
[TXT]Acheulian Culture in Peninsular India An Ecological Perspective 1st Published2013-10-12T17:50:00+00:00 23 MB 
[TXT]The Hunchback of Notre - Dame Reprint2013-10-13T15:09:00+00:00 20 MB 
[TXT]Man in Indian Tradition Vidyapati's Discourse on Purusa 1st2013-10-14T12:28:00+00:00 20 MB 
[TXT]Rural Development and Population 1st Edition2013-10-15T09:47:00+00:00 24 MB 
[TXT]US National Missile Defense Strategy Policy Documents 1st Edition2013-10-16T07:06:00+00:00 17 MB 
[TXT]Office Organisation2013-10-17T04:25:00+00:00 17 MB 
[TXT]The Kingdom of Afghanistan A Historical Sketch Reprint Bombay 1911 Edition2013-10-18T01:44:00+00:00 19 MB 
[TXT]Wise and Wonderful The Animal Alphabet Quiz Book2013-10-18T23:03:00+00:00 19 MB 
[TXT]Mathematics of Genome Analysis 1st Edition2013-10-19T20:22:00+00:00 22 MB 
[TXT]Global Terror 1st Edition2013-10-20T17:41:00+00:00 19 MB 
[TXT]Environment, 2001 A Global Challenge2013-10-21T15:00:00+00:00 17 MB 
[TXT]Indian Books in Print, 1991 A Bibliography of Indian Books Published in English Language2013-10-22T12:19:00+00:00 19 MB 
[TXT]Encyclopaedia of Project Management 2 Vols. 1st Edition2013-10-23T09:38:00+00:00 21 MB 
[TXT]India and Tibet Vol. 6 1st Edition2013-10-24T06:57:00+00:00 19 MB 
[TXT]Select Specimens of the Theatre of the Hindus Translated from Original Sanskrit Literature 2 Vols. R2013-10-25T04:16:00+00:00 19 MB 
[TXT]Encyclopaedia of Technical Terms2013-10-26T01:35:00+00:00 21 MB 
[TXT]History of Hindu Mathematics 2 Vols.2013-10-26T22:54:00+00:00 17 MB 
[TXT]The Citrakarmasastra Ascribed to Manjusri Being Volume II of Vastuvidyasastra Vol. 2 1st Edition2013-10-27T20:13:00+00:00 21 MB 
[TXT]Portuguese in India 2 Vols. 1st Edition2013-10-28T17:32:00+00:00 17 MB 
[TXT]N.D. Basu's Criminal Court Handbook Containing Criminal Minor Acts2013-10-29T14:51:00+00:00 18 MB 
[TXT]1941-1948 Vol. 22013-10-30T12:10:00+00:00 25 MB 
[TXT]Occidental Daughters of Mother India 3 Vols. 1st Edition2013-10-31T09:29:00+00:00 20 MB 
[TXT]Sister Nivedita and Pondicherry Mother Vol. 3 1st Edition2013-11-01T06:48:00+00:00 17 MB 
[TXT]Perspectives in Measurement and Evaluation of Education 5 Vols. 1st Edition2013-11-02T04:07:00+00:00 18 MB 
[TXT]Encyclopaedia of Animal Physiology 13 Vols. 1st Edition2013-11-03T01:26:00+00:00 23 MB 
[TXT]A Collection of the Inscriptions on Copper Plates and Stones in the Nellore Districts2013-11-03T22:45:00+00:00 23 MB 
[TXT]Encyclopaedia of Value and Moral Education 5 Vols. 3rd Edition2013-11-04T20:04:00+00:00 19 MB 
[TXT]Practice and Research in Literacy 1st Edition2013-11-05T17:23:00+00:00 18 MB 
[TXT]Encyclopaedia of Physical Education and Sports Sciences2013-11-06T14:42:00+00:00 19 MB 
[TXT]Encyclopaedia of Education and Culture in Free India 25 Vols. 1st Edition2013-11-07T12:01:00+00:00 25 MB 
[TXT]Organic Chemistry Vol. 1 1st Edition2013-11-08T09:20:00+00:00 19 MB 
[TXT]Cuddapah District Gazetteers Vol. 1 Reprint Madras 1915 edition2013-11-09T06:39:00+00:00 20 MB 
[TXT]Culture Through the Ages Prof. B.N. Puri Felicitation Volume 1st Edition2013-11-10T03:58:00+00:00 22 MB 
[TXT]Early Hindu India A Dynastic Study and Cultural History of Early Indian Civilization 3 Vols.2013-11-11T01:17:00+00:00 19 MB 
[TXT]Handbook on Women and Human Rights A Guide for Social Activists 2 Vols.2013-11-11T22:36:00+00:00 20 MB 
[TXT]Economic Development, Planning and Policy in India2013-11-12T19:55:00+00:00 18 MB 
[TXT]Buffalo West Wing2013-11-13T17:14:00+00:00 18 MB 
[TXT]Waking Nightmare2013-11-14T14:33:00+00:00 21 MB 
[TXT]The Taking2013-11-15T11:52:00+00:00 23 MB 
[TXT]Betsy Ross2013-11-16T09:11:00+00:00 18 MB 
[TXT]The Man Who Disappeared2013-11-17T06:30:00+00:00 22 MB 
[TXT]Primary and Elementary Education Policy and Programmes Growth and Development Organisation and Manag2013-11-18T03:49:00+00:00 24 MB 
[TXT]Healing Mind, Body and Soul Reprint2013-11-19T01:08:00+00:00 17 MB 
[TXT]How to Develop Profitable Listening Skills A Handbook for Developing Most Effective and Efficient Li2013-11-19T22:27:00+00:00 24 MB 
[TXT]The Complete Guide to Modern Essays2013-11-20T19:46:00+00:00 20 MB 
[TXT]The Sterling Book of Idioms2013-11-21T17:05:00+00:00 20 MB 
[TXT]The Sterling Book of Concise Dictionary of English for Everyday Use2013-11-22T14:24:00+00:00 24 MB 
[TXT]Snooker2013-11-23T11:43:00+00:00 22 MB 
[TXT]A Crafty Session : Politician Jokes2013-11-24T09:02:00+00:00 23 MB 
[TXT]Bottoms up with Drinking Jokes2013-11-25T06:21:00+00:00 22 MB 
[TXT]India and East Asia Culture and Society2013-11-26T03:40:00+00:00 21 MB 
[TXT]Chemistry : Objective Type Questions with Answers2013-11-27T00:59:00+00:00 21 MB 
[TXT]Handbook of Research Methodology in History2013-11-27T22:18:00+00:00 24 MB 
[TXT]Public Administration Concepts and Theories2013-11-28T19:37:00+00:00 19 MB 
[TXT]Sex Expert Guidance from the Sexologist to Help You Spice up Your Love Life2013-11-29T16:56:00+00:00 18 MB 
[TXT]Pregnancy2013-11-30T14:15:00+00:00 18 MB 
[TXT]India On a New Threshold 1st Edition2013-12-01T11:34:00+00:00 25 MB 
[TXT]Advanced Dictionary of Journalism 1st Edition2013-12-02T08:53:00+00:00 17 MB 
[TXT]Mystery of Death of Subhash Chandra Bose2013-12-03T06:12:00+00:00 22 MB 
[TXT]The Rebellious Rani of Belavadi and Other Stories 1st Edition2013-12-04T03:31:00+00:00 21 MB 
[TXT]Rediscovering America American Studies in the New Century2013-12-05T00:50:00+00:00 21 MB 
[TXT]Selected Tales from Arabian Nights Selected from the Original Sixteen Volumes of the Book of the Th2013-12-05T22:09:00+00:00 20 MB 
[TXT]Problems in Physics For JEE-IIT and Equivalent Examinations Vol. 32013-12-06T19:28:00+00:00 17 MB 
[TXT]Semiotica Indica Encyclopaedic Dictionary of Body-Language in Indian Art and Culture 2 Vols. 1st Edi2013-12-07T16:47:00+00:00 20 MB 
[TXT]1937-1996 Dissertations and Theses Vol. 22013-12-08T14:06:00+00:00 24 MB 
[TXT]The Early History of Islam 2 Vols. in 12013-12-09T11:25:00+00:00 22 MB 
[TXT]Encyclopaedic Dictionary of Genetics and Organic Evolution 3 Vols. 1st Edition2013-12-10T08:44:00+00:00 17 MB 
[TXT]Prakrti The Integral Vision 5 Vols. 1st Published in India2013-12-11T06:03:00+00:00 25 MB 
[TXT]Encyclopaedia of Women and Development 20 Vols. 1st Edition2013-12-12T03:22:00+00:00 21 MB 
[TXT]Recent Advances in Plant Biology Dr. R.N. Kapil Felicitation Volume2013-12-13T00:41:00+00:00 23 MB 
[TXT]Selected Works of Maulana Abul Kalam Azad2013-12-13T22:00:00+00:00 20 MB 
[TXT]Text and Hindi Translation2013-12-14T19:19:00+00:00 23 MB 
[TXT]The Complete Works of William Shakespeare Vol. 2 Reprint2013-12-15T16:38:00+00:00 22 MB 
[TXT]Ourstory Indian Response to Nineteenth Century Literature 3 Vols.2013-12-16T13:57:00+00:00 25 MB 
[TXT]Outlines of Indian Philology2013-12-17T11:16:00+00:00 22 MB 
[TXT]Journey to the North of India Overland from England, Through Russia, Persia and Afghanistan Vol. 1 R2013-12-18T08:35:00+00:00 21 MB 
[TXT]The Skanda Purana2013-12-19T05:54:00+00:00 18 MB 
[TXT]Encyclopaedia of Food Science 3 Vols. 1st Edition2013-12-20T03:13:00+00:00 22 MB 
[TXT]Encyclopaedia of Teaching of Economics 3 Vols. 1st Edition2013-12-21T00:32:00+00:00 23 MB 
[TXT]Politics and the People In Search of Humane India2013-12-21T21:51:00+00:00 19 MB 
[TXT]Social Transformation in India Essays in Honour of Professor I.P. Desai Vol. 1 1st Edition2013-12-22T19:10:00+00:00 25 MB 
[TXT]Social Transformation in India Essays in Honour of Professor I.P. Desai Vol. 2 1st Edition2013-12-23T16:29:00+00:00 25 MB 
[TXT]Various Political Parties Small Groups2013-12-24T13:48:00+00:00 18 MB 
[TXT]Social Transformation in India Professor Madan Lal Sharma Felicitation Volume2013-12-25T11:07:00+00:00 23 MB 
[TXT]A Miscellany Vol. 32013-12-26T08:26:00+00:00 20 MB 
[TXT]Encyclopaedia of the Universe : A Popular Work on the Marvels of the Heavens, the Earth, Plant, Lif2013-12-27T05:45:00+00:00 19 MB 
[TXT]Patterns of Decentralised Governance in Rural India2013-12-28T03:04:00+00:00 23 MB 
[TXT]Encyclopaedic Dictionary of Biological Sciences 6 Vols. Reprint2013-12-29T00:23:00+00:00 21 MB 
[TXT]The Earth Has No Corners Felicitation Volume on the 70th Birthday of Dr. Karan Singh 1st Published i2013-12-29T21:42:00+00:00 20 MB 
[TXT]The Narada-purana Part 1 1st Edition2013-12-30T19:01:00+00:00 21 MB 
[TXT]Phonology and Morphophonemics2013-12-31T16:20:00+00:00 25 MB 
[TXT]Papers in Language and Linguistics Vol. 22014-01-01T13:39:00+00:00 20 MB 
[TXT]The Gazetteer of Bombay City and Island 3 Vols. 1st Cosmo Print2014-01-02T10:58:00+00:00 18 MB 
[TXT]Recent Advances in Plant Pathology2014-01-03T08:17:00+00:00 24 MB 
[TXT]Personnel Management Theory and Practice2014-01-04T05:36:00+00:00 18 MB 
[TXT]Proceedings of the Eleventh National Power Systems Conference NPSC - 20002014-01-05T02:55:00+00:00 17 MB 
[TXT]Researches in Indian Archaeology, Art, Architecture, Culture and Religion Prof. Vijayakanta Mishra2014-01-06T00:14:00+00:00 25 MB 
[TXT]Socio-Economic Profile of Rural India 4 Vols. 1st Edition2014-01-06T21:33:00+00:00 17 MB 
[TXT]Mandalas-6,7,8 Vol. 3 2nd Revised Edition2014-01-07T18:52:00+00:00 20 MB 
[TXT]Patterns of Regional Geography An International Perspective 3 Vols.2014-01-08T16:11:00+00:00 22 MB 
[TXT]Sri Ramachandrika Professor Oruganti Ramachandraiya Festschrift : Essays on Indian Archaeology, His2014-01-09T13:30:00+00:00 22 MB 
[TXT]Reference Catalogue of Indian Books in print in English, Vol. 2 Author Index with a Directory of Pu2014-01-10T10:49:00+00:00 24 MB 
[TXT]Wind Engineering Retrospect and Prospect2014-01-11T08:08:00+00:00 18 MB 
[TXT]Societal Structure and Social Problems 3 Vols. 1st Edition2014-01-12T05:27:00+00:00 23 MB 
[TXT]Lakshadweep2014-01-13T02:46:00+00:00 25 MB 
[TXT]Theoretical Perspectives in Education2014-01-14T00:05:00+00:00 17 MB 
[TXT]Papers in Language and Linguistics Vol. 12014-01-14T21:24:00+00:00 23 MB 
[TXT]Research in Social Sciences Professor Amreshwar Avasthi Felicitation Volume2014-01-15T18:43:00+00:00 18 MB 
[TXT]Wondrous Whispers of Wisdom from Ancient India For Better Life-Management in the New Millennium2014-01-16T16:02:00+00:00 21 MB 
[TXT]The Variegated Plumage Encounters with Indian Philosophy : A Commemoration Volume in Honour of Pandi2014-01-17T13:21:00+00:00 25 MB 
[TXT]Working Women and Children 6 Vols. 1st Edition2014-01-18T10:40:00+00:00 19 MB 
[TXT]A History of the Great Revolt 3 Vols. Reprint2014-01-19T07:59:00+00:00 17 MB 
[TXT]Rama in Indian Literature, Art and Thought 2 Vols. 1st Edition2014-01-20T05:18:00+00:00 24 MB 
[TXT]Hall of Fame and Plant Pathology2014-01-21T02:37:00+00:00 17 MB 
[TXT]World Trade Organisation Text Vol. 22014-01-21T23:56:00+00:00 24 MB 
[TXT]Rambles and Recollections of an Indian Official Vol. 2 Reprint Westminster 1893 Edition2014-01-22T21:15:00+00:00 21 MB 
[TXT]Travels in South-Eastern Asia Embracing Hindustan, Malaya, Siam and China with Notices of Numerous M2014-01-23T18:34:00+00:00 17 MB 
[TXT]Vishnudharmottara Purana Translated into English from Original Sanskrit Text 3 Vols. 1st Edition2014-01-24T15:53:00+00:00 25 MB 
[TXT]Visvambhara Probings in Orientology : Prof. V.S. Pathak Festschrift2014-01-25T13:12:00+00:00 20 MB 
[TXT]Western Political Thought From Bentham to Present Day Vol. 22014-01-26T10:31:00+00:00 25 MB 
[TXT]Trends in Biomembranes and Bioenergetics, Vol. 12014-01-27T07:50:00+00:00 22 MB 
[TXT]Travels in Tartary, Thibet and China During the Years, 1844-1846 Vol. 1 Reprint London 1851 Edition2014-01-28T05:09:00+00:00 24 MB 
[TXT]World's Greatest Socialist Thinkers 25 Vols. 1st Edition2014-01-29T02:28:00+00:00 22 MB 
[TXT]Trends in Chemical Engineering2014-01-29T23:47:00+00:00 24 MB 
[TXT]Trends in Chemical Physics, Vol. 82014-01-30T21:06:00+00:00 17 MB 
[TXT]Readings in Financial Management 4 Vols.2014-01-31T18:25:00+00:00 23 MB 
[TXT]Aspects of Environment and Resource Ecology of Garhwal2014-02-01T15:44:00+00:00 24 MB 
[TXT]Structures of Significations2014-02-02T13:03:00+00:00 18 MB 
[TXT]The Book of the Forest Vol. 3 Reprint2014-02-03T10:22:00+00:00 20 MB 
[TXT]Recent Advances in Entomology 10 Vols. 1st Edition2014-02-04T07:41:00+00:00 20 MB 
[TXT]Tribal Languages of Ladakh2014-02-05T05:00:00+00:00 25 MB 
[TXT]Readings in the Indian Parliamentary Opposition 2 Vols. 1st Edition2014-02-06T02:19:00+00:00 22 MB 
[TXT]Readings on Information Technology 2 Vols. 1st Edition2014-02-06T23:38:00+00:00 24 MB 
[TXT]Tribes and Tribal Life 3 Vols.2014-02-07T20:57:00+00:00 25 MB 
[TXT]The Later Mughals Vol. I : 1707-1720, Vol. II : 1719-1739 2 Vols. in 1 Reprint2014-02-08T18:16:00+00:00 24 MB 
[TXT]Trends in Chemical Physics, Vol. 42014-02-09T15:35:00+00:00 19 MB 
[TXT]Women in Contemporary Indian Society 2 Vols.2014-02-10T12:54:00+00:00 21 MB 
[TXT]Its Validity and Its Sources Vol. 1 1st Edition2014-02-11T10:13:00+00:00 20 MB 
[TXT]Canto Ten, Chapters 1 to 4 Vol. 1 1st Edition2014-02-12T07:32:00+00:00 25 MB 
[TXT]The Indian Precambrian A Volume in Honour of Professor Ashit Baran Roy 1st Edition2014-02-13T04:51:00+00:00 24 MB 
[TXT]The Ancient History of the World2014-02-14T02:10:00+00:00 23 MB 
[TXT]Aranya-Kanda, Kishkindha-Kanda, Sundara-Kanda Vol. 22014-02-14T23:29:00+00:00 25 MB 
[TXT]World Labour Report 1993-94, Vol. 6 & 7 Reprint2014-02-15T20:48:00+00:00 17 MB 
[TXT]English Translation of Adhyaya One with Sanskrit Text, Transliteration, Word-Boundary, Anuvrtti, Vrt2014-02-16T18:07:00+00:00 17 MB 
[TXT]Third World Sociology 2 Vols. 1st Edition2014-02-17T15:26:00+00:00 19 MB 
[TXT]Studies in Tribal, Rural and Urban Development 2 Vols. 1st Edition2014-02-18T12:45:00+00:00 22 MB 
[TXT]The Standard Cyclopaedia of Modern Agriculture and Rural Economy 12 Vols. 1st Edition2014-02-19T10:04:00+00:00 20 MB 
[TXT]Top Cops Biographies of World's Top Policem2014-02-20T07:23:00+00:00 25 MB 
[TXT]Sumati-Sangitabharanam = Gems of Indian Music and Musicology Prof. Sumati Mutatkar Felicitation Volu2014-02-21T04:42:00+00:00 19 MB 
[TXT]Introductory Microbiology2014-02-22T02:01:00+00:00 25 MB 
[TXT]Essentials of Tuberculosis in Children 1st Edition2014-02-22T23:20:00+00:00 20 MB 
[TXT]Understanding Medical Physiology A Textbook for Medical Students2014-02-23T20:39:00+00:00 24 MB 
[TXT]Perceptional Cartography and District Planning2014-02-24T17:58:00+00:00 25 MB 
[TXT]Growth, Stability and Equity in Agriculture A Quantitative Analysis 1st Edition2014-02-25T15:17:00+00:00 24 MB 
[TXT]Personality Issues in Assessment and the Projective Inventory Approach 1st Edition2014-02-26T12:36:00+00:00 24 MB 
[TXT]Private Development Aid in Transition2014-02-27T09:55:00+00:00 17 MB 
[TXT]Atlas of the Child in India2014-02-28T07:14:00+00:00 18 MB 
[TXT]Commercial Geography of a Metropolitan City Spatial Structure of Retailing in Bombay 1st Published2014-03-01T04:33:00+00:00 21 MB 
[TXT]Developmental Migration A Processual Analysis of Inter-State Rural : Rural Migration2014-03-02T01:52:00+00:00 17 MB 
[TXT]Dynamics of Development in Gujarat 1st Edition2014-03-02T23:11:00+00:00 23 MB 
[TXT]Geography of Marketing and Commercial Activities in India Documentation on Research Information (CI2014-03-03T20:30:00+00:00 22 MB 
[TXT]Geography of Plants The Uses of Principal Cultivated Plants on which the Prosperity of Nations is B2014-03-04T17:49:00+00:00 20 MB 
[TXT]Poverty in Metropolitian Cities2014-03-05T15:08:00+00:00 18 MB 
[TXT]Regional Perspectives in Agricultural Development A Case Study of Wheat and Rice in Selected Region2014-03-06T12:27:00+00:00 24 MB 
[TXT]Residential Pattern of Suburbs2014-03-07T09:46:00+00:00 22 MB 
[TXT]Pharmaceutical Biotechnology2014-03-08T07:05:00+00:00 25 MB 
[TXT]Advanced Learner's Dictionary of Accounting 1st Edition2014-03-09T04:24:00+00:00 22 MB 
[TXT]Environmental Pollution and Agriculture2014-03-10T01:43:00+00:00 20 MB 
[TXT]Development of Citizenship Habits Among Indigenous People 1st Edition2014-03-10T23:02:00+00:00 20 MB 
[TXT]Vedanta and Future of Mankind2014-03-11T20:21:00+00:00 19 MB 
[TXT]Ten Short Stories by Suresh Joshi English Translation of Gujarati Short Stories 1st Edition2014-03-12T17:40:00+00:00 20 MB 
[TXT]Physical Organic Chemistry 1st Edition2014-03-13T14:59:00+00:00 21 MB 
[TXT]Pioneers in Scientific Discoveries 1st Edition2014-03-14T12:18:00+00:00 24 MB 
[TXT]Sleep-wakefulness 1st Edition2014-03-15T09:37:00+00:00 18 MB 
[TXT]Buddhanusmrti A Glossary of Buddhist Terms 1st Edition2014-03-16T06:56:00+00:00 23 MB 
[TXT]Cookery Wizard 1st Edition2014-03-17T04:15:00+00:00 22 MB 
[TXT]Corporate Strategies New Age Weapons for Excellence2014-03-18T01:34:00+00:00 20 MB 
[TXT]Distance Open Learning Challenges to Developing Countries 1st Published in India2014-03-18T22:53:00+00:00 18 MB 
[TXT]Relaxation for Health and Success Stress Reducing Techniques for Confidence and Positive Health 2nd2014-03-19T20:12:00+00:00 25 MB 
[TXT]In The Name of Child Labour Eradication and Evaluation Programme 1st Edition2014-03-20T17:31:00+00:00 19 MB 
[TXT]Knowledge Management in Libraries2014-03-21T14:50:00+00:00 22 MB 
[TXT]Namamala Ã’r a Work on Pali Grammar2014-03-22T12:09:00+00:00 19 MB 
[TXT]Urban Development and Management 1st Edition2014-03-23T09:28:00+00:00 24 MB 
[TXT]Armageddon : The Battler in the Heaven Between Good and Evil and other Poetic Pearls 1st Edition2014-03-24T06:47:00+00:00 25 MB 
[TXT]The Cambridge Illustrated History Religions2014-03-25T04:06:00+00:00 25 MB 
[TXT]Performance Appraisal of Mutual Funds in India2014-03-26T01:25:00+00:00 25 MB 
[TXT]Managing Global Competitiveness : What Indian Companies Must Do 1st Edition2014-03-26T22:44:00+00:00 23 MB 
[TXT]The Dancing Biography and Shovana Narayan2014-03-27T20:03:00+00:00 20 MB 
[TXT]Indian Prime Ministership A Comprehensive Study 1st Edition2014-03-28T17:22:00+00:00 18 MB 
[TXT]Methods in Biotechnology and Bioengineering For Pharmacy and Other Biosciences 1st Edition2014-03-29T14:41:00+00:00 17 MB 
[TXT]Elements of Biblical Ethics2014-03-30T12:00:00+00:00 22 MB 
[TXT]Ethics on Health Care A Critique2014-03-31T09:19:00+00:00 23 MB 
[TXT]Global Research on Drainage in Agriculture An Annotated Bibliography, 1960-19862014-04-01T06:38:00+00:00 21 MB 
[TXT]Television in Kheda : A Social Evalution of SITE2014-04-02T03:57:00+00:00 20 MB 
[TXT]Planning for Forest Resources and Bio-Diversity Management Principles, Organization and Methodology2014-04-03T01:16:00+00:00 22 MB 
[TXT]Law and Practice of Character and Integrity Rolls 2nd Edition2014-04-03T22:35:00+00:00 23 MB 
[TXT]Central Administrative Tribunal Digest, 1995-19962014-04-04T19:54:00+00:00 24 MB 
[TXT]Commentaries on Mental Health Act, 1987 With Supplement2014-04-05T17:13:00+00:00 22 MB 
[TXT]How to Become An Immigrant to Canada and the United States of America2014-04-06T14:32:00+00:00 21 MB 
[TXT]Immoral Traffic (Prevention) Act, 1956 4th Edition, With Supplement2014-04-07T11:51:00+00:00 21 MB 
[TXT]Swaraj : The Problem of India2014-04-08T09:10:00+00:00 22 MB 
[TXT]Crime : Its Cause and Treatment2014-04-09T06:29:00+00:00 25 MB 
[TXT]Distribution of Refinery Products in India2014-04-10T03:48:00+00:00 25 MB 
[TXT]Cultural and Structural Dimensions of Family : A Study of Jalari Fishermen2014-04-11T01:07:00+00:00 20 MB 
[TXT]Faith Possesses Understanding : A Suggestion for A New Direction in Retional Theology2014-04-11T22:26:00+00:00 22 MB 
[TXT]Numbers Their Iconographic Consideration in Buddhist and Hindu Practices 1st Published2014-04-12T19:45:00+00:00 25 MB 
[TXT]Information Management in Government2014-04-13T17:04:00+00:00 18 MB 
[TXT]The Loneliness of a Long Distant Future Dilemmas of Contemporary Architecture 1st Published2014-04-14T14:23:00+00:00 22 MB 
[TXT]Indian Defence Yearbook - 20022014-04-15T11:42:00+00:00 18 MB 
[TXT]Partition and Genocide Manifestation of Violence in Punjab, 1937-19472014-04-16T09:01:00+00:00 19 MB 
[TXT]Mathematics Enjoyment for the Millions Second Revised Edition Enlarged with 50 Brain Sharpeners and2014-04-17T06:20:00+00:00 24 MB 
[TXT]Lifelong Education 1st Edition2014-04-18T03:39:00+00:00 20 MB 
[TXT]Economics, Planning and Public Administration2014-04-19T00:58:00+00:00 25 MB 
[TXT]Price Levels and Economic Growth2014-04-19T22:17:00+00:00 21 MB 
[TXT]Studies in Capital Formation, Saving and Investment in a Developing Economy2014-04-20T19:36:00+00:00 24 MB 
[TXT]Philosophy of Sex2014-04-21T16:55:00+00:00 25 MB 
[TXT]Salads and Raitas Fiesta2014-04-22T14:14:00+00:00 19 MB 
[TXT]Legendary Biju The Man and Mission 1st Edition2014-04-23T11:33:00+00:00 23 MB 
[TXT]Aesthetics of Indian Folk Dance2014-04-24T08:52:00+00:00 20 MB 
[TXT]The Malayalese The People, Their History, and Culture 5 Vols. 1st Edition2014-04-25T06:11:00+00:00 24 MB 
[TXT]Encyclopaedic Dictionary of Literary Terms 2 Vols. 1st Edition2014-04-26T03:30:00+00:00 18 MB 
[TXT]The Akbar Nama of Abul-L-Fazl Translated from the Persian Vol. 32014-04-27T00:49:00+00:00 25 MB 
[TXT]Total Quality Management 3 Vols.2014-04-27T22:08:00+00:00 23 MB 
[TXT]The Cambridge World History of Food 2 Vols.2014-04-28T19:27:00+00:00 23 MB 
[TXT]The Masterpiece Library of Short Stories 20 Vols.2014-04-29T16:46:00+00:00 21 MB 
[TXT]The Treatise on Indian Medicinal Plants Vol. 4 Reprint2014-04-30T14:05:00+00:00 18 MB 
[TXT]Books VIII, IX and X Vol. 4 Reprint2014-05-01T11:24:00+00:00 24 MB 
[TXT]The Selected Novels2014-05-02T08:43:00+00:00 19 MB 
[TXT]The Witings of Kwang-3Ze, Books XVIII-XXXIII, the Thai-Shang Tractate of Actions and Their Retributi2014-05-03T06:02:00+00:00 18 MB 
[TXT]United Nations on Human Rights 2 Vols. 1st Edition2014-05-04T03:21:00+00:00 19 MB 
[TXT]Encyclopaedia of Political Parties India, Pakistan, Bangladesh - National, Regional, Local2014-05-05T00:40:00+00:00 23 MB 
[TXT]India and her Problems2014-05-05T21:59:00+00:00 21 MB 
[TXT]Information Technology Applications in Libraries 1st Edition2014-05-06T19:18:00+00:00 19 MB 
[TXT]Infomedia in Higher Education 1st Edition2014-05-07T16:37:00+00:00 20 MB 
[TXT]Bharat's Supreme Court on Direct Taxes, 1950-1998 With Case Review2014-05-08T13:56:00+00:00 22 MB 
[TXT]Company Law Digest, 1913-1993 With English Cases and Judicial Analysis 2 Vols.2014-05-09T11:15:00+00:00 17 MB 
[TXT]Recent Advances in Medicinal, Aromatic, and Spice Crops International Conference Held on 28-31, Jan2014-05-10T08:34:00+00:00 24 MB 
[TXT]Tropical Sketches, or, Reminiscences of an Indian Journalist 2 Vols. Reprint London, 1855 Edition2014-05-11T05:53:00+00:00 19 MB 
[TXT]The Paradoxes of Partition (1937-47) 1937-39 Vol. 1 1st Edition2014-05-12T03:12:00+00:00 22 MB 
[TXT]Agricultural Terminology 1st Edition2014-05-13T00:31:00+00:00 17 MB 
[TXT]Uncommons in the Commons Community Initiated Forest Reourse Management : With Botanical Input 1st Pu2014-05-13T21:50:00+00:00 23 MB 
[TXT]Constitutional Reforms Problems, Prospects and Perspectives 2nd Edition2014-05-14T19:09:00+00:00 22 MB 
[TXT]Seers, Deities and Metres in Vedas 1st Edition2014-05-15T16:28:00+00:00 22 MB 
[TXT]K.P. Chakravarti's Words and Phrases Under the Constitution of Indi2014-05-16T13:47:00+00:00 19 MB 
[TXT]Vedanta-Chandamrita, (Prasthanatrayi Se Cayana) : The Vedanta Verses : An Annotative Anthology of th2014-05-17T11:06:00+00:00 24 MB 
[TXT]Political Thinkers of the World 2 Vols.2014-05-18T08:25:00+00:00 20 MB 
[TXT]Katha, Prize Stories, Volume 92014-05-19T05:44:00+00:00 19 MB 
[TXT]Treatise on FERA (Law and Practice) : A Commentary on the Foreign Exchange Regulation Act, 1973 : wi2014-05-20T03:03:00+00:00 18 MB 
[TXT]Triratna Heritage, Governance and Equity : Honble Shri T.N. Chaturvedi Festschrift 5 Vols. 1st Edit2014-05-21T00:22:00+00:00 24 MB 
[TXT]Financial Management in Development Banks 1st Edition2014-05-21T21:41:00+00:00 25 MB 
[TXT]Life and Works of Booker Prize Winners 1st Edition2014-05-22T19:00:00+00:00 17 MB 
[TXT]Education and Society 1st Edition2014-05-23T16:19:00+00:00 25 MB 
[TXT]Grassroots Economics The Poverty of Agricultural Labourers 1st Edition2014-05-24T13:38:00+00:00 21 MB 
[TXT]Major Constitutions Government and Politics in U.K., U.S.A., Switzerland and China 2 Vols. 1st Editi2014-05-25T10:57:00+00:00 24 MB 
[TXT]Preschool Education & An Intergrated Preschool Curriculum 1st Edition2014-05-26T08:16:00+00:00 25 MB 
[TXT]A Textbook of Algae 1st Edition2014-05-27T05:35:00+00:00 20 MB 
[TXT]Chordate Embryology 1st Edition2014-05-28T02:54:00+00:00 20 MB 
[TXT]The Tabaqat-I-Akbari of Khwajah Nizamuddin Ahmad A History of India from the Early Musalman Invasion2014-05-29T00:13:00+00:00 22 MB 
[TXT]The Travels of Pietro Della Valle in India [From the Old English Translation of 1664, by G. Havers]2014-05-29T21:32:00+00:00 20 MB 
[TXT]The Gospel of Love : Glimpses of 'sri Ram2014-05-30T18:51:00+00:00 25 MB 
[TXT]The Jataka, or Stories of the Buddha's Former Births Vol. 4 Reprint Cambrid2014-05-31T16:10:00+00:00 17 MB 
[TXT]Manasollasa and Ayurveda 1st Edition2014-06-01T13:29:00+00:00 20 MB 
[TXT]Commercial Banking 1st Edition2014-06-02T10:48:00+00:00 20 MB 
[TXT]Srimad Bhagavadgita Rahasya or Karma-Yoga-Sastra2014-06-03T08:07:00+00:00 19 MB 
[TXT]Reference Manual for UGC Examinations NET, SLET, JRF and other UPSC Competitive Tests : Economics 1s2014-06-04T05:26:00+00:00 20 MB 
[TXT]Mass Communication Theory and Practice in the 21st Century 1st Edition2014-06-05T02:45:00+00:00 21 MB 
[TXT]International Ecotourism Environmental Rules and Regulations 1st Edition2014-06-06T00:04:00+00:00 24 MB 
[TXT]Educating the Nation Documents on the Discourse of National Educational of India, 1880-1920 1st Publ2014-06-06T21:23:00+00:00 25 MB 
[TXT]Bodhisattva and Sunyata In the Early and Developed Buddhist Traditions 1st Edition2014-06-07T18:42:00+00:00 20 MB 
[TXT]Yoga-Nidra : Yogic Trance Theory, Practice and Applications 1st Published2014-06-08T16:01:00+00:00 17 MB 
[TXT]Architecture of Bhoslas of Nagpur 2 Vols. 1st Edition2014-06-09T13:20:00+00:00 22 MB 
[TXT]The Sorcerer-King and the "Great Abortion&a2014-06-10T10:39:00+00:00 17 MB 
[TXT]Himalayan Snow and Glaciers Associated Environmental Problems, Progress and Prospects 1st Published2014-06-11T07:58:00+00:00 22 MB 
[TXT]Problems of Primary School Drop-Outs 1st Edition2014-06-12T05:17:00+00:00 23 MB 
[TXT]Creativity in Student Teachers2014-06-13T02:36:00+00:00 17 MB 
[TXT]Educational Philosophic Beliefs 1st Edition2014-06-13T23:55:00+00:00 17 MB 
[TXT]Methods of Teaching Educational Technology 1st Edition2014-06-14T21:14:00+00:00 18 MB 
[TXT]Methods of Teaching Civics 1st Edition2014-06-15T18:33:00+00:00 19 MB 
[TXT]Methods of Teaching Commerce 1st Edition2014-06-16T15:52:00+00:00 18 MB 
[TXT]Plural Identities and Political Choices of the Muslim Community2014-06-17T13:11:00+00:00 18 MB 
[TXT]Forgotten Identities Women Artisans of Kashmir 1st Edition2014-06-18T10:30:00+00:00 22 MB 
[TXT]Transformative Organizations A Global Perspective 1st Edition2014-06-19T07:49:00+00:00 20 MB 
[TXT]Advertising Basics! A Resource Guide for Beginners 6th Printing2014-06-20T05:08:00+00:00 21 MB 
[TXT]Paradigms of Learning The Total Literacy Campaign in India 1st Published2014-06-21T02:27:00+00:00 21 MB 
[TXT]Livestock Epigenetics2014-06-21T23:46:00+00:00 22 MB 
[TXT]Guided Waves in Structures for SHM The Time - Domain Spectral Element Method2014-06-22T21:05:00+00:00 22 MB 
[TXT]MCQs in Periodontology with Explanation2014-06-23T18:24:00+00:00 18 MB 
[TXT]All Creation Groans with Pain2014-06-24T15:43:00+00:00 19 MB 
[TXT]Tiny the Snow Dog Export Edition2014-06-25T13:02:00+00:00 23 MB 
[TXT]Materials on European Criminal Law2014-06-26T10:21:00+00:00 24 MB 
[TXT]Quest Intro Level Reading and Writing EZ Test CD-ROM2014-06-27T07:40:00+00:00 19 MB 
[TXT]Blue-Blooded Vamp2014-06-28T04:59:00+00:00 20 MB 
[TXT]Clinical Microbiology Made Ridiculously Simple 4th Edition2014-06-29T02:18:00+00:00 19 MB 
[TXT]Mastering Orthopedic Techniques Spine Surgery 1st Edition2014-06-29T23:37:00+00:00 19 MB 
[TXT]The Ultimate Why Question Why Is There Anything at All Rather than Nothing Whatsoever?2014-06-30T20:56:00+00:00 22 MB 
[TXT]Sure Success in BDS IV Year, Vol. 12014-07-01T18:15:00+00:00 21 MB 
[TXT]Nightshade City Book I OF The NightshadeChronicles2014-07-02T15:34:00+00:00 20 MB 
[TXT]Trucks and Diggers2014-07-03T12:53:00+00:00 22 MB 
[TXT]Select Works of Sri Sankaracharya Sanskrit Text and English Tranlation 1st Cosmo Print2014-07-04T10:12:00+00:00 24 MB 
[TXT]Peasant Movements in Post-Colonial India Dynamics of Mobilization and Identity 1st Edition2014-07-05T07:31:00+00:00 21 MB 
[TXT]Sociology of Religion in India 1st Edition2014-07-06T04:50:00+00:00 23 MB 
[TXT]Reforming Secondary Education 1st Edition2014-07-07T02:09:00+00:00 25 MB 
[TXT]Bangladesh Road to Sustainable Development People's Voice2014-07-07T23:28:00+00:00 24 MB 
[TXT]Symbol, Script and Writing (From Petrogram to Printing and Further) 1st Edition2014-07-08T20:47:00+00:00 24 MB 
[TXT]The Markandeya-Puranam Indroduction, Sanskrit Text English Translation with Notes and Index of Verse2014-07-09T18:06:00+00:00 23 MB 
[TXT]Islamic Architecture of Deccan (With Special Emphasis on Rayalaseema Region) 1st Published2014-07-10T15:25:00+00:00 18 MB 
[TXT]Sociological Foundations of Education 1st Edition2014-07-11T12:44:00+00:00 24 MB 
[TXT]Ancient Indian Surgery Based On Susruta Samhita2014-07-12T10:03:00+00:00 22 MB 
[TXT]The Light of the Upanisads 1st Edition2014-07-13T07:22:00+00:00 21 MB 
[TXT]Environmental Approach in Geography Teaching 1st Edition2014-07-14T04:41:00+00:00 23 MB 
[TXT]Buddhist Philosophy of Social Activism 1st Edition2014-07-15T02:00:00+00:00 19 MB 
[TXT]Buddhist Tantricism 1st Edition2014-07-15T23:19:00+00:00 19 MB 
[TXT]Theory of Social Leadership 1st Edition2014-07-16T20:38:00+00:00 17 MB 
[TXT]Vikramorvasiyam = Urvashi and Pururavas Global Paperback Edition2014-07-17T17:57:00+00:00 24 MB 
[TXT]Dhammapadapali and Suttanipata, (Dhammapadapali evam Suttanipata), Vol. 10 Pali Text With English T2014-07-18T15:16:00+00:00 17 MB 
[TXT]Mother Divine : The Supreme Being Meditation on the Vision of Eternal Presence : An Exposition of Pe2014-07-19T12:35:00+00:00 20 MB 
[TXT]Gender Related Problems of Women, Women's Empowerment and Panchayati Raj 1st Edition2014-07-20T09:54:00+00:00 22 MB 
[TXT]Law of Electricity in India : As Amended by the Electricity Laws (Amendment) Act, 1998 (Act No. 222014-07-21T07:13:00+00:00 22 MB 
[TXT]Mitra on Hindu Law 3rd Edition, Reprint2014-07-22T04:32:00+00:00 25 MB 
[TXT]Insights into the Mongolian Crescent of India2014-07-23T01:51:00+00:00 24 MB 
[TXT]The Untouchables Subordination, Poverty and the State in Modern India 1st Edition2014-07-23T23:10:00+00:00 22 MB 
[TXT]Indian Vegetable Culture for Hills and Plains2014-07-24T20:29:00+00:00 20 MB 
[TXT]Gentlemen Poets in Colonial Bengal Emergent Nationalism and the Orientalist Project 1st Edition2014-07-25T17:48:00+00:00 23 MB 
[TXT]Keeping The Air Clean (The Junior Library of Ecology)2014-07-26T15:07:00+00:00 24 MB 
[TXT]TQM in the Service Sector Reprint2014-07-27T12:26:00+00:00 18 MB 
[TXT]Social Philosophy of the Mahabharata and Manusmriti2014-07-28T09:45:00+00:00 25 MB 
[TXT]Breeding in Crop Plants Mutations and in Vitro Mutation Breeding 1st Edition, Reprint2014-07-29T07:04:00+00:00 24 MB 
[TXT]Litchi Botany, Production and Utilization 1st Edition2014-07-30T04:23:00+00:00 20 MB 
[TXT]Seed Science and Technology2014-07-31T01:42:00+00:00 18 MB 
[TXT]A Gospels Encyclopaedia 1st Edition2014-07-31T23:01:00+00:00 24 MB 
[TXT]Geriatrics in Ayurveda 1st Edition2014-08-01T20:20:00+00:00 22 MB 
[TXT]Child Care in Ancient India from the Perspectives of Developmental Psychology and Paediatrics 1st Ed2014-08-02T17:39:00+00:00 24 MB 
[TXT]Frontiers in Fungal Biotechnology and Plant Pathogen Relations Proceedings of the Conference Held f2014-08-03T14:58:00+00:00 17 MB 
[TXT]At Every Breat - A Teaching : Stories About The Life and Teaching of Swami Chinmayananda2014-08-04T12:17:00+00:00 25 MB 
[TXT]Suravaram Pratapa Reddy Telugu Writer2014-08-05T09:36:00+00:00 25 MB 
[TXT]Synergising HRD Interventions Challenges and Initiatives2014-08-06T06:55:00+00:00 18 MB 
[TXT]A Guide to Educating Children With Learning Disabilities 1st Edition2014-08-07T04:14:00+00:00 17 MB 
[TXT]Wordoodles Poems2014-08-08T01:33:00+00:00 24 MB 
[TXT]The Seven-Walled Fort and Other Poems 1st Edition2014-08-08T22:52:00+00:00 17 MB 
[TXT]Existence 2nd Edition2014-08-09T20:11:00+00:00 21 MB 
[TXT]Paging the Unknown2014-08-10T17:30:00+00:00 21 MB 
[TXT]Industrial Pollution Technologies for Abatement and Control2014-08-11T14:49:00+00:00 23 MB 
[TXT]Economic Analysis of Environmental Problems in Tanneries and Textile Bleaching and Dyeing Units and2014-08-12T12:08:00+00:00 22 MB 
[TXT]Lal's Commentaries on Water and Air Pollution and Environment (Protection) Laws Along with2014-08-13T09:27:00+00:00 17 MB 
[TXT]Three Nes-Pas or Tridosa Vijnana (Chapters I to IV of Man-nag Rgyud or Upadesa-tantra or the text on2014-08-14T06:46:00+00:00 22 MB 
[TXT]Selected Works of Maulana Abul Kalam Azad, 1943-46 Vol. 22014-08-15T04:05:00+00:00 17 MB 
[TXT]Selected Works of Maulana Abul Kalam Azad Vol. 92014-08-16T01:24:00+00:00 18 MB 
[TXT]Oriental Numismatic Studies Vol. 2 1st Edition2014-08-16T22:43:00+00:00 22 MB 
[TXT]Origin & Development of Legal &a2014-08-17T20:02:00+00:00 19 MB 
[TXT]Encyclopaedia of World Women 10 Vols.2014-08-18T17:21:00+00:00 17 MB 
[TXT]Principles and Theory of Political Science Vol. 22014-08-19T14:40:00+00:00 19 MB 
[TXT]Encyclopaedia of the Indian Biography 8 Vols.2014-08-20T11:59:00+00:00 17 MB 
[TXT]The Foundation of Muslim Nationalism Vol. 12014-08-21T09:18:00+00:00 18 MB 
[TXT]Small Scale Industries2014-08-22T06:37:00+00:00 19 MB 
[TXT]Recent Trends in Chordates 6 Vols. 1st Edition2014-08-23T03:56:00+00:00 20 MB 
[TXT]The Farmers Encyclopaedia and Dictionary of Rural Development2014-08-24T01:15:00+00:00 19 MB 
[TXT]Socio-Economic Survey of Bhilai Region Part 12014-08-24T22:34:00+00:00 19 MB 
[TXT]Rediscovering India India's Philosophy Library 71 Vols.2014-08-25T19:53:00+00:00 24 MB 
[TXT]The Forgotten Monuments of Orissa Vol. 22014-08-26T17:12:00+00:00 17 MB 
[TXT]Himachal Pradesh2014-08-27T14:31:00+00:00 22 MB 
[TXT]South Indian Inscriptions2014-08-28T11:50:00+00:00 21 MB 
[TXT]Rhymes Through Prayer, Praise and Song2014-08-29T09:09:00+00:00 25 MB 
[TXT]Heteropters2014-08-30T06:28:00+00:00 24 MB 
[TXT]String Theory2014-08-31T03:47:00+00:00 21 MB 
[TXT]Samadhipada Vol. 12014-09-01T01:06:00+00:00 20 MB 
[TXT]Recent Advances in Embryology 5 Vols. 1st Edition2014-09-01T22:25:00+00:00 17 MB 
[TXT]The Masnavi 2 Vols. 1st Edition2014-09-02T19:44:00+00:00 17 MB 
[TXT]Introduction Vol. 1 1st Edition2014-09-03T17:03:00+00:00 22 MB 
[TXT]The New Gresham Encyclopaedia of the World 12 Vols.2014-09-04T14:22:00+00:00 24 MB 
[TXT]Taxmann's Companies Act as Amendment by Companies (2014-09-05T11:41:00+00:00 25 MB 
[TXT]The Pakistan Gazetteer 7 Vols.2014-09-06T09:00:00+00:00 23 MB 
[TXT]Teaching Tribals Through Gramsevak and Voluntary Agency2014-09-07T06:19:00+00:00 18 MB 
[TXT]Unknown Soldier and Other Poems 1st Edition2014-09-08T03:38:00+00:00 25 MB 
[TXT]Our Freedom Struggle : 1857-1947 1st Edition2014-09-09T00:57:00+00:00 21 MB 
[TXT]Coalition Politics The Indian Experience 1st Edition2014-09-09T22:16:00+00:00 17 MB 
[TXT]Tradition and Transmission Current Trends in French Ethnology : The Relevance for India 1st Edition2014-09-10T19:35:00+00:00 20 MB 
[TXT]Encyclopaedia of Educational Technology 4 Vols. 1st Edition2014-09-11T16:54:00+00:00 21 MB 
[TXT]Sports Medicine and Management A Practical Approach 2 Vols. 1st Edition2014-09-12T14:13:00+00:00 19 MB 
[TXT]Kevala-Bodhi Buddhist and Jaina History of the Deccan (The BSL Commemorative Volume) 2 Vols. 1st Edi2014-09-13T11:32:00+00:00 24 MB 
[TXT]Theories of Education and Education in the Emerging Indian Society 2 Vols. 1st Edition2014-09-14T08:51:00+00:00 23 MB 
[TXT]The Latest Portfolio of Theory & Practice in Gymnosperm 1st Edition2014-09-15T06:10:00+00:00 22 MB 
[TXT]Trans-Himalaya Discoveries and Adventures in Tibet 3 Vols. Indian Edition2014-09-16T03:29:00+00:00 24 MB 
[TXT]In an Eastern Rose Garden Vol. 7 Reprint2014-09-17T00:48:00+00:00 19 MB 
[TXT]Problems of Educational Backwardness 1st Edition2014-09-17T22:07:00+00:00 21 MB 
[TXT]War on Poverty For Taking Poor to Portals of Civil Life 1st Edition2014-09-18T19:26:00+00:00 23 MB 
[TXT]Learn to Play on Flute Including Shahnai, Been and Piccolo 33rd Edition2014-09-19T16:45:00+00:00 23 MB 
[TXT]International Dimension of the Sri Lankan Conflict Threat and Response2014-09-20T14:04:00+00:00 21 MB 
[TXT]The Indian Annual Register A Digest of Public Affairs of India Regarding the Nation&2014-09-21T11:23:00+00:00 21 MB 
[TXT]Orchid Culture in Ceylon and the East Reprint Colombo 1918 Edition2014-09-22T08:42:00+00:00 21 MB 
[TXT]The Architecture of Knowledge Quantum Mechanics, Neuroscience, Computers and Consiousness 1st Editio2014-09-23T06:01:00+00:00 22 MB 
[TXT]Think Before Getting Grey 1st Edition2014-09-24T03:20:00+00:00 20 MB 
[TXT]Theory and Applications of Microeconomics2014-09-25T00:39:00+00:00 22 MB 
[TXT]The Variation of Animals and Plants Under Domestication With Illustration 2 Vols.2014-09-25T21:58:00+00:00 17 MB 
[TXT]Pondicherry 1st Published2014-09-26T19:17:00+00:00 24 MB 
[TXT]Malavikagnimitram Malavika and Agnimitra2014-09-27T16:36:00+00:00 21 MB 
[TXT]The Story of My Heart My Autobiography2014-09-28T13:55:00+00:00 17 MB 
[TXT]Medicinal Plants New Vistas of Research Vol. 12014-09-29T11:14:00+00:00 19 MB 
[TXT]The Great Gurus of the Sikhs 6 Vols. 1st Edition2014-09-30T08:33:00+00:00 23 MB 
[TXT]Educational Technology Knowledge Assessment 1st Edition, Reprint2014-10-01T05:52:00+00:00 23 MB 
[TXT]Rabindranath Tagore Images of Women: Selected Poems 1st Edition2014-10-02T03:11:00+00:00 25 MB 
[TXT]Sharadatilakatantram - Part I Vol. 102014-10-03T00:30:00+00:00 19 MB 
[TXT]Among the Temples of China 1st Edition2014-10-03T21:49:00+00:00 22 MB 
[TXT]Fiction Vol. 2 2nd Revised & Enlarged Edition2014-10-04T19:08:00+00:00 22 MB 
[TXT]A Textbook of Environmental Science 1st Edition2014-10-05T16:27:00+00:00 19 MB 
[TXT]The Dynamic Geosphere Professor William Sefton Fyfe Felicitation Volume2014-10-06T13:46:00+00:00 20 MB 
[TXT]The Questions of King Milinda Vol. 2 Reprint2014-10-07T11:05:00+00:00 19 MB 
[TXT]Advanced Learner's Dictionary of Information Technology 1st Edi2014-10-08T08:24:00+00:00 22 MB 
[TXT]The Giant Awakens Punjab Industry and Growth 1st Edition2014-10-09T05:43:00+00:00 25 MB 
[TXT]The Caraka Samhita 5 Vols. 2nd Revised and Enlarged Edition2014-10-10T03:02:00+00:00 25 MB 
[TXT]Operative Considerations in Ancient Indian Surgery Based on Chapters Samhita, Cikitsa-Sthana, Chapte2014-10-11T00:21:00+00:00 23 MB 
[TXT]Indigenous Characteristics of Mughal Architecture 1st Published2014-10-11T21:40:00+00:00 20 MB 
[TXT]Become a High Achiever2014-10-12T18:59:00+00:00 23 MB 
[TXT]A Peep into Yaksagana and Sanskrit Dramaturgy2014-10-13T16:18:00+00:00 22 MB 
[TXT]Development of Women An Assessment 1st Edition2014-10-14T13:37:00+00:00 17 MB 
[TXT]Economic Reforms Sans Development2014-10-15T10:56:00+00:00 18 MB 
[TXT]How the Brain Got Language The Mirror System Hypothesis2014-10-16T08:15:00+00:00 25 MB 
[TXT]A Quiet Revolution The Veil&2014-10-17T05:34:00+00:00 21 MB 
[TXT]Formation and Properties of Clay-Polymer Complexes 2nd Illustrated Edition2014-10-18T02:53:00+00:00 22 MB 
[TXT]Chicano Discourse Socio-historic Perspectives2014-10-19T00:12:00+00:00 20 MB 
[TXT]The Rational Good A Study in the Logic of Practice 1st Indian Edition2014-10-19T21:31:00+00:00 17 MB 
[TXT]Nyayadarsana of Gotama Text, Vatsayayana Commentary and English Translation 8 Vols.2014-10-20T18:50:00+00:00 17 MB 
[TXT]School Organisation 1st Edition2014-10-21T16:09:00+00:00 17 MB 
[TXT]The Northeast Complexities and its Determinants 1st Edition2014-10-22T13:28:00+00:00 25 MB 
[TXT]Psychology of Learning and Development Development of Learning and Teaching-Learning Process 1st Edi2014-10-23T10:47:00+00:00 25 MB 
[TXT]Education, Polity and Society A Study of Education and Democratic Consciousness 1st Edition, Reprint2014-10-24T08:06:00+00:00 21 MB 
[TXT]Hindu Nationalism and Democracy 1st Edition, Reprint2014-10-25T05:25:00+00:00 22 MB 
[TXT]Adult Education in India Some Reflections 1st Edition2014-10-26T02:44:00+00:00 21 MB 
[TXT]Understanding the Social Sphere The Village and Beyond2014-10-27T00:03:00+00:00 17 MB 
[TXT]India and Australasia History, Culture and Society 1st Edition2014-10-27T21:22:00+00:00 17 MB 
[TXT]Development, Gender and Diaspora Context of Globalisation2014-10-28T18:41:00+00:00 17 MB 
[TXT]Ancient and Medieval Nepal 1st Paperback Edition2014-10-29T16:00:00+00:00 21 MB 
[TXT]Brahma-Sutras Sanskrit Text, English Translation, Commentary and Notes 2 Vols. 1st Edition2014-10-30T13:19:00+00:00 20 MB 
[TXT]Methods of Teaching Computer Science 1st Edition2014-10-31T10:38:00+00:00 18 MB 
[TXT]Fish Ponds For The Farms Reprint2014-11-01T07:57:00+00:00 24 MB 
[TXT]Revealing Advaita Vedant 8 Vols. 1st Edition2014-11-02T05:16:00+00:00 24 MB 
[TXT]Investigating Social Capital Comparative Perspectives on Civil Society, Participation and Governance2014-11-03T02:35:00+00:00 24 MB 
[TXT]Arun Joshi's Novels A Critical Study 1st Edition2014-11-03T23:54:00+00:00 22 MB 
[TXT]Albert Einstein Selected Writings2014-11-04T21:13:00+00:00 22 MB 
[TXT]Miyazawa Kenji's Ten Japanese Stories for Children 1st Published2014-11-05T18:32:00+00:00 19 MB 
[TXT]Providing Education for All2014-11-06T15:51:00+00:00 22 MB 
[TXT]Women in India Retrospect and Prospect2014-11-07T13:10:00+00:00 17 MB 
[TXT]Tropical, Subtropical Fruits and Flowers Cultivation2014-11-08T10:29:00+00:00 20 MB 
[TXT]Swami Ram The Poet Monk of the Punjab2014-11-09T07:48:00+00:00 24 MB 
[TXT]Introduction Vol. 1 2nd Revised and Enlarged Edition2014-11-10T05:07:00+00:00 21 MB 
[TXT]Devyagama Vol. 5 2nd Revised and Enlarged Edition2014-11-11T02:26:00+00:00 22 MB 
[TXT]Ancient Tales of Wit, Wisdom and Humour The Best of Mulla Nasruddin, Tenali Rama, Appaji Rao and Ma2014-11-11T23:45:00+00:00 22 MB 
[TXT]Modern Theories of Library Cataloguing2014-11-12T21:04:00+00:00 20 MB 
[TXT]The Other Indians Essays on Pastoralists and Prehistoric Tribal People2014-11-13T18:23:00+00:00 17 MB 
[TXT]The Problems of Work2014-11-14T15:42:00+00:00 17 MB 
[TXT]Genetic Diversity and Food Security2014-11-15T13:01:00+00:00 17 MB 
[TXT]Motivational Analysis in Music and Dance2014-11-16T10:20:00+00:00 18 MB 
[TXT]Text Book of Vector Dynamics 1st Published2014-11-17T07:39:00+00:00 21 MB 
[TXT]Life of Buddha2014-11-18T04:58:00+00:00 25 MB 
[TXT]Tourism and Biodiversity2014-11-19T02:17:00+00:00 21 MB 
[TXT]Physical Education, Fitness and Sports2014-11-19T23:36:00+00:00 24 MB 
[TXT]Studies in Literature in English Vol. 2 1st Edition2014-11-20T20:55:00+00:00 17 MB 
[TXT]Encyclopaedia of Modern Educational Technology 3 Vols.2014-11-21T18:14:00+00:00 24 MB 
[TXT]Encyclopaedic Ethnography of the Himalayan Tribes 4 Vols. 1st Edition2014-11-22T15:33:00+00:00 19 MB 
[TXT]Priyadarsika 1st Edition2014-11-23T12:52:00+00:00 22 MB 
[TXT]Resource Transfer and Debt Trap2014-11-24T10:11:00+00:00 18 MB 
[TXT]Principles of Fruit Preservation 1st Edition2014-11-25T07:30:00+00:00 24 MB 
[TXT]Encyclopaedic Dictionary of Economics2014-11-26T04:49:00+00:00 24 MB 
[TXT]The Indian State After Independence2014-11-27T02:08:00+00:00 24 MB 
[TXT]Administrative Reforms and Orissa's Development2014-11-27T23:27:00+00:00 19 MB 
[TXT]The Comptroller and Auditor General of India An Analytical History, 1947-19892014-11-28T20:46:00+00:00 20 MB 
[TXT]Ayurveda, the Science of Living Health and Vigour Forever 1st Edition2014-11-29T18:05:00+00:00 21 MB 
[TXT]RA-Sakyamitra Vol. 10 1st Edition2014-11-30T15:24:00+00:00 24 MB 
[TXT]Pervasive Terms Vyapti Vol. 1 2nd Revised Edition2014-12-01T12:43:00+00:00 22 MB 
[TXT]Role of Voluntary Organisations in Tribal Development2014-12-02T10:02:00+00:00 18 MB 
[TXT]Energy, Ecology and Environment A Technological Approach 1st Edition2014-12-03T07:21:00+00:00 20 MB 
[TXT]Agricultural Marketing in India The Case of Regulated Agricultural Markets in Uttar Pradesh, 1998-992014-12-04T04:40:00+00:00 19 MB 
[TXT]Azadirachta Indica A. Juss, Syn. Melia Azadirachta Linn, Neem, Family Meliaceae2014-12-05T01:59:00+00:00 17 MB 
[TXT]Indian Economy and Socio-Economic Transformation Emerging Issues and Problems : Essays in Honour of2014-12-05T23:18:00+00:00 19 MB 
[TXT]Carbon and Carbon Materials Recent Trends : Indo Carbon 2003 : Conference Proceedings 1st Edition2014-12-06T20:37:00+00:00 19 MB 
[TXT]Information Technology in Libraries 1st Edition2014-12-07T17:56:00+00:00 21 MB 
[TXT]Agriculture and WTO Opportunity for India 1st Edition2014-12-08T15:15:00+00:00 18 MB 
[TXT]Beekeeping For Profit and Pleasure Indian Reprint2014-12-09T12:34:00+00:00 21 MB 
[TXT]Indian Constitution2014-12-10T09:53:00+00:00 18 MB 
[TXT]Solomon's Saga of a Wild Life Sanctuary Veerangana Durgavati Ab2014-12-11T07:12:00+00:00 21 MB 
[TXT]Gendered Realities, Human Spaces The Writing of Shashi Deshpande 1st Edition2014-12-12T04:31:00+00:00 18 MB 
[TXT]A Killer in Kailash 1st Published2014-12-13T01:50:00+00:00 20 MB 
[TXT]Blue Gold The Fight to Stop the Corporate Theft of the World's Water Reprint2014-12-13T23:09:00+00:00 23 MB 
[TXT]The Beginner's Cook Book Eggs 1st Edition2014-12-14T20:28:00+00:00 24 MB 
[TXT]Conservation, Displacement, and Deprivation Maldhari of Gir Forest of Gujarat2014-12-15T17:47:00+00:00 25 MB 
[TXT]Century of Light Bahai World Centre 2nd Edition2014-12-16T15:06:00+00:00 24 MB 
[TXT]Indian Diaspora in Asian and Pacific Regions Culture, People, Interactions 1st Edition2014-12-17T12:25:00+00:00 17 MB 
[TXT]Death2014-12-18T09:44:00+00:00 24 MB 
[TXT]E-Governance A Choice to Upgrade India's Rural Economy2014-12-19T07:03:00+00:00 19 MB 
[TXT]Electronic Principles Applications and Devices2014-12-20T04:22:00+00:00 20 MB 
[TXT]Dictionary of Alternative Meaning2014-12-21T01:41:00+00:00 18 MB 
[TXT]Dictionary of Idoms (i.e. Idioms) and Pharases (i.e. Phrases) 1st Edition2014-12-21T23:00:00+00:00 22 MB 
[TXT]Emotional Freedom Techniques Revised Edition, Reprint2014-12-22T20:19:00+00:00 23 MB 
[TXT]Crimes in Cyber Space Scams and Frauds : Issues and Remedies2014-12-23T17:38:00+00:00 18 MB 
[TXT]Manuring for Higher Crop Production Reprint2014-12-24T14:57:00+00:00 19 MB 
[TXT]Diagnostic Radiology and Imaging2014-12-25T12:16:00+00:00 24 MB 
[TXT]Loricata Testudines Vol. 1 2nd Edition2014-12-26T09:35:00+00:00 20 MB 
[TXT]Sauria Vol. 2 2nd Edition2014-12-27T06:54:00+00:00 19 MB 
[TXT]Everyday Entrepreneurs The Harbingers of Prosperity and the Creators of Jobs2014-12-28T04:13:00+00:00 23 MB 
[TXT]Sucheta Kripalani Great Women of Modern India2014-12-29T01:32:00+00:00 19 MB 
[TXT]Feeling The Philosophy of Bhagavad Gita 1st Edition2014-12-29T22:51:00+00:00 24 MB 
[TXT]Feminism in India Issues in Contemporary Indian Feminism 1st Edition2014-12-30T20:10:00+00:00 23 MB 
[TXT]India's National Security Annual Review, 202014-12-31T17:29:00+00:00 24 MB 
[TXT]Distance Learning Technologies in Education 1st Edition2015-01-01T14:48:00+00:00 25 MB 
[TXT]10 Essential Foods A Sensible, Good-Humored Approach to Vitality, Health, and Well-Being Reprint2015-01-02T12:07:00+00:00 20 MB 
[TXT]History of Anthropology Revised Edition2015-01-03T09:26:00+00:00 20 MB 
[TXT]Folk Dances of Chamba Where Every Talk is a 'song and E2015-01-04T06:45:00+00:00 19 MB 
[TXT]Library and Information Profession in India Dr. P.S.G. Kumar festschrift2015-01-05T04:04:00+00:00 22 MB 
[TXT]International Finance and Global Macroeconomics2015-01-06T01:23:00+00:00 24 MB 
[TXT]International Mediation in the Inter Ethnic Conflict in Eastern Europe 1st Edition2015-01-06T22:42:00+00:00 22 MB 
[TXT]Selected Punjabi Short Stories 1st Edition2015-01-07T20:01:00+00:00 21 MB 
[TXT]Indian Democracy and Governance Essays in Honour of Professor R.N. Pal 1st Edition2015-01-08T17:20:00+00:00 20 MB 
[TXT]Recent Trends in Manufacturing CARTM-2003, November 14-15, 20032015-01-09T14:39:00+00:00 21 MB 
[TXT]Re-Engineering Library and Information Services Process, People and Technology2015-01-10T11:58:00+00:00 19 MB 
[TXT]Gandhian Alternative to Contemporary Problems 1st Edition2015-01-11T09:17:00+00:00 19 MB 
[TXT]Resources Management for Sustainable Development 1st Edition2015-01-12T06:36:00+00:00 25 MB 
[TXT]Road to Brand Equity 1st Edition2015-01-13T03:55:00+00:00 20 MB 
[TXT]Gita Today 1st Edition2015-01-14T01:14:00+00:00 23 MB 
[TXT]Sahni's Hindi-English Dictionary With Illustrations Hindi-Angreji Sabdakosa2015-01-14T22:33:00+00:00 22 MB 
[TXT]Differing Interpretations of the Torah in Matthew's Gospel A Narrative-Crit2015-01-15T19:52:00+00:00 25 MB 
[TXT]Hospital Supportive Services Hospital Administration in the 21st Century 1st Edition2015-01-16T17:11:00+00:00 19 MB 
[TXT]Integrated Child Development Services A Study of Job Performance of Supervisors2015-01-17T14:30:00+00:00 20 MB 
[TXT]Morphogenesis2015-01-18T11:49:00+00:00 20 MB 
[TXT]Prehistoric Life 1st Edition2015-01-19T09:08:00+00:00 22 MB 
[TXT]Foreign Trade and The World Trade Organisation 1st Edition2015-01-20T06:27:00+00:00 20 MB 
[TXT]Economics of Tourism and Development 1st Edition2015-01-21T03:46:00+00:00 17 MB 
[TXT]Information Management2015-01-22T01:05:00+00:00 24 MB 
[TXT]Health Education 1st Edition2015-01-22T22:24:00+00:00 19 MB 
[TXT]India Book of the Year, 2004 Events of December, 2002 to November, 20032015-01-23T19:43:00+00:00 24 MB 
[TXT]Security and Diplomacy Essential Documents 1st Edition2015-01-24T17:02:00+00:00 25 MB 
[TXT]Science of Hypnosis 2nd Reprint2015-01-25T14:21:00+00:00 20 MB 
[TXT]Sitar and Its Compositions 1st Edition2015-01-26T11:40:00+00:00 24 MB 
[TXT]Shamsur Rahman A Witness of his Times 2nd Edition2015-01-27T08:59:00+00:00 24 MB 
[TXT]Sins of My Youth2015-01-28T06:18:00+00:00 23 MB 
[TXT]Disparities in ICT Access and Use2015-01-29T03:37:00+00:00 22 MB 
[TXT]Evolution of Information and Communication Technologies2015-01-30T00:56:00+00:00 17 MB 
[TXT]Smoking Cigarettes The Unfiltered Truth Understanding Why and How to Quit2015-01-30T22:15:00+00:00 19 MB 
[TXT]Some Aspects of Agricultural Credit in a Developing Economy 1st Edition2015-01-31T19:34:00+00:00 20 MB 
[TXT]Spiritual Culture of India and Other Essays 1st Edition2015-02-01T16:53:00+00:00 19 MB 
[TXT]The Political and Statistical, History of Gujarat Translated from the Persian of Ali Mohammed Khan,2015-02-02T14:12:00+00:00 24 MB 
[TXT]Paediatric and Gynaecological Considerations and Aphorisms in Ancient Indian Surgery Based on Chapte2015-02-03T11:31:00+00:00 22 MB 
[TXT]Desert in Bloom Contemporary Indian Women's Fiction in English 1st Edition2015-02-04T08:50:00+00:00 21 MB 
[TXT]Taxmann's Master Guide to Income Tax Act With Commentary on2015-02-05T06:09:00+00:00 22 MB 
[TXT]Harvest of Hatred The Concerned Citizens Tribunal Report on Gujarat, 20022015-02-06T03:28:00+00:00 17 MB 
[TXT]Hercolubus or Red Planet 1st Indian Edition2015-02-07T00:47:00+00:00 24 MB 
[TXT]Inscriptions of the Vijayanagara Rulers Inscriptions of the Rulers of the Sangama Dynasty, 1336 A.D.2015-02-07T22:06:00+00:00 25 MB 
[TXT]The Potato Production and Utilization in Sub-Tropics2015-02-08T19:25:00+00:00 24 MB 
[TXT]The Quality Assurance Manual2015-02-09T16:44:00+00:00 25 MB 
[TXT]Jainism and Indian Civilization 1st Published2015-02-10T14:03:00+00:00 23 MB 
[TXT]The New Wine-Skins The Story of the Indigenous Missions in Coastal Andhra Pradesh, India2015-02-11T11:22:00+00:00 21 MB 
[TXT]Judicial Activism and Accountability2015-02-12T08:41:00+00:00 17 MB 
[TXT]Kamalahasan The Consummate Actor2015-02-13T06:00:00+00:00 20 MB 
[TXT]Trade Union as a Social Institution of Change Korea2015-02-14T03:19:00+00:00 21 MB 
[TXT]Traditional Exports of India Performance and Prospects2015-02-15T00:38:00+00:00 17 MB 
[TXT]Spirituality2015-02-15T21:57:00+00:00 23 MB 
[TXT]A-Z of Law in Management 1st Edition2015-02-16T19:16:00+00:00 23 MB 
[TXT]Textbook of Information Technology 1st Edition2015-02-17T16:35:00+00:00 22 MB 
[TXT]Local Government Rural and Urban : For UGC-NET, M.A., UPSC and State Public Service Commission Exam2015-02-18T13:54:00+00:00 22 MB 
[TXT]Terrorism in South Asia Views From India 1st Edition2015-02-19T11:13:00+00:00 20 MB 
[TXT]Mainstreaming Micro Finance2015-02-20T08:32:00+00:00 24 MB 
[TXT]Women in India Problems and Prospects2015-02-21T05:51:00+00:00 19 MB 
[TXT]World Trade and Development Report, 2003 Cancun and Beyond2015-02-22T03:10:00+00:00 19 MB 
[TXT]The Primacy of the Political2015-02-23T00:29:00+00:00 20 MB 
[TXT]The Private Lives of World Famous People2015-02-23T21:48:00+00:00 18 MB 
[TXT]End of Life Issues2015-02-24T19:07:00+00:00 18 MB 
[TXT]Nuri Granth The Sacred Songs of Sadhu T.L. Vaswani (Nuri)2015-02-25T16:26:00+00:00 22 MB 
[TXT]Islam and Peace in the 21st Century2015-02-26T13:45:00+00:00 18 MB 
[TXT]The Science of Infant Feeding2015-02-27T11:04:00+00:00 21 MB 
[TXT]Modern Dictionary of Eco-Environment2015-02-28T08:23:00+00:00 17 MB 
[TXT]Modern Teaching of History Strictly According to the UGC Syllabus For B.Ed. Course2015-03-01T05:42:00+00:00 22 MB 
[TXT]Money, Banking and Public Finance Based on UGC Model Curriculum : 2002 For B.A. (Pass/Hons.) Econom2015-03-02T03:01:00+00:00 17 MB 
[TXT]Performance Banking and Rural Development2015-03-03T00:20:00+00:00 20 MB 
[TXT]Mother-Goddesses in Kathmandu2015-03-03T21:39:00+00:00 18 MB 
[TXT]Jammu and Kashmir2015-03-04T18:58:00+00:00 24 MB 
[TXT]Ritual and the Quest for Truth2015-03-05T16:17:00+00:00 25 MB 
[TXT]Poverty Among Scheduled Castes A Study2015-03-06T13:36:00+00:00 17 MB 
[TXT]Manusmrti With the Sanskrit Commentary Manvartha-Muktavati of Kulluka Bhatta2015-03-07T10:55:00+00:00 18 MB 
[TXT]Principles of Teaching in Elementary Schools2015-03-08T08:14:00+00:00 23 MB 
[TXT]The Archaeology of Middle Ganga Plain New Perspectives (Excavations at Agiabir) 1st Edition2015-03-09T05:33:00+00:00 19 MB 
[TXT]Transition Towards Sustainable Development in South Asia2015-03-10T02:52:00+00:00 22 MB 
[TXT]Terror on the High Seas 1st Edition2015-03-11T00:11:00+00:00 17 MB 
[TXT]Law of Contempt of Court in India2015-03-11T21:30:00+00:00 19 MB 
[TXT]Feminine Sensibility in the Novels of Margaret Drabble An Interpretation and Evaluation2015-03-12T18:49:00+00:00 17 MB 
[TXT]Letters for All Occasions2015-03-13T16:08:00+00:00 24 MB 
[TXT]Hand Book on Ayurvedic Medicines With Formulae, Processes and Their Uses2015-03-14T13:27:00+00:00 21 MB 
[TXT]Hand Book on Spices2015-03-15T10:46:00+00:00 17 MB 
[TXT]Indian Estuaries2015-03-16T08:05:00+00:00 23 MB 
[TXT]Babur the Tiger2015-03-17T05:24:00+00:00 19 MB 
[TXT]War in Iraq and New World Order2015-03-18T02:43:00+00:00 25 MB 
[TXT]Decision Support System2015-03-19T00:02:00+00:00 24 MB 
[TXT]Issues in Digital Cataloguing2015-03-19T21:21:00+00:00 20 MB 
[TXT]Existential Authenticity An Examination2015-03-20T18:40:00+00:00 21 MB 
[TXT]Miracles in Our Bodies2015-03-21T15:59:00+00:00 23 MB 
[TXT]Handbook of Environment2015-03-22T13:18:00+00:00 20 MB 
[TXT]Participatory Learning & Action2015-03-23T10:37:00+00:00 18 MB 
[TXT]Recent Trends in Power Management2015-03-24T07:56:00+00:00 18 MB 
[TXT]Social Security in a Developing World Context2015-03-25T05:15:00+00:00 19 MB 
[TXT]The Trodden Path Essays on Regional and Micro-Level Planning2015-03-26T02:34:00+00:00 21 MB 
[TXT]Women and Child Education 1st Edition2015-03-26T23:53:00+00:00 19 MB 
[TXT]Tourism Strategies for Rural Development2015-03-27T21:12:00+00:00 17 MB 
[TXT]Winning Amidst Unexpected Unknowns2015-03-28T18:31:00+00:00 25 MB 
[TXT]Managing Information, Knowledge and Power in the Cyber Age Essays in Honour of Prof. R.G. Prasher2015-03-29T15:50:00+00:00 18 MB 
[TXT]Memoirs of My Indonesian Lecture Tour2015-03-30T13:09:00+00:00 25 MB 
[TXT]India in Sri Lanka Between Lion and the Tigers2015-03-31T10:28:00+00:00 17 MB 
[TXT]I Am Sorry (IAS) Indian Bureaucracy at Crossroads2015-04-01T07:47:00+00:00 19 MB 
[TXT]Experimental Psychology with Advanced Experiments2015-04-02T05:06:00+00:00 19 MB 
[TXT]North East India Assam, Manipur, Tripura, Nagaland2015-04-03T02:25:00+00:00 20 MB 
[TXT]Healthcare and Nursing Family2015-04-03T23:44:00+00:00 22 MB 
[TXT]Anarchism A Political Reader2015-04-04T21:03:00+00:00 17 MB 
[TXT]Global Justice Liberation and Socialism2015-04-05T18:22:00+00:00 25 MB 
[TXT]Guide for Obesity Diabetes Hypertension and Other Cardiac Problems2015-04-06T15:41:00+00:00 23 MB 
[TXT]My Amazing India Daybook2015-04-07T13:00:00+00:00 24 MB 
[TXT]New World Economy Changing Dimensions of Commerce Clause : Internet as Instrumentality of Commerce2015-04-08T10:19:00+00:00 19 MB 
[TXT]Tax Incentives and Economic Growth An International Comparison UK, USA, France, Japan, Singapore,2015-04-09T07:38:00+00:00 21 MB 
[TXT]The Novels of Rohinton Mistry A Critical Study2015-04-10T04:57:00+00:00 17 MB 
[TXT]British Lions and Indian Tigers2015-04-11T02:16:00+00:00 18 MB 
[TXT]Anthelmintics and Antimycotics2015-04-11T23:35:00+00:00 23 MB 
[TXT]Heterocyclic Chemistry2015-04-12T20:54:00+00:00 22 MB 
[TXT]Educational Environment A Key to Effective Teaching2015-04-13T18:13:00+00:00 22 MB 
[TXT]Daughter of the Mountains2015-04-14T15:32:00+00:00 21 MB 
[TXT]Handbook of Alternative Therapies2015-04-15T12:51:00+00:00 23 MB 
[TXT]Hinduism Rediscovering the Mystical2015-04-16T10:10:00+00:00 19 MB 
[TXT]Recent Advances in Natural Language Processing Proceedings of the International Conference on Natur2015-04-17T07:29:00+00:00 24 MB 
[TXT]History and Organisation of Indian Police2015-04-18T04:48:00+00:00 19 MB 
[TXT]Cops Code of Conduct2015-04-19T02:07:00+00:00 24 MB 
[TXT]Contemporary South Asia2015-04-19T23:26:00+00:00 23 MB 
[TXT]Manpower Profile India, Yearbook, 20032015-04-20T20:45:00+00:00 25 MB 
[TXT]Teachings of Mahabharata2015-04-21T18:04:00+00:00 19 MB 
[TXT]Spices, Vol. 1 Traditional Uses &2015-04-22T15:23:00+00:00 19 MB 
[TXT]The Curse of the Goddess 1st Published2015-04-23T12:42:00+00:00 24 MB 
[TXT]Inquiry into the Nature of Moral Principles2015-04-24T10:01:00+00:00 23 MB 
[TXT]Plates XV-CLXIV2015-04-25T07:20:00+00:00 25 MB 
[TXT]Laws Relating to Cooperative Societies A Commentary2015-04-26T04:39:00+00:00 17 MB 
[TXT]Southeast Asian Crisis An Economic Analysis2015-04-27T01:58:00+00:00 22 MB 
[TXT]A Textbook of Special Education2015-04-27T23:17:00+00:00 24 MB 
[TXT]Experimental Biotechnology2015-04-28T20:36:00+00:00 22 MB 
[TXT]A Textbook of Teacher Education2015-04-29T17:55:00+00:00 23 MB 
[TXT]Love Management2015-04-30T15:14:00+00:00 20 MB 
[TXT]Advances in Horticulture and Forestry, Volume 2, 19922015-05-01T12:33:00+00:00 22 MB 
[TXT]Narrative Construction of India Forster, Nehru and Rushdie2015-05-02T09:52:00+00:00 23 MB 
[TXT]Layout and Marking in Track and Field2015-05-03T07:11:00+00:00 24 MB 
[TXT]State of the Indian Farmer A Millennium Study 27 Vols. 1st Edition2015-05-04T04:30:00+00:00 20 MB 
[TXT]Teaching of Mathematics New Trends and Innovations2015-05-05T01:49:00+00:00 19 MB 
[TXT]Teaching of Economics New Trends and Innovations2015-05-05T23:08:00+00:00 21 MB 
[TXT]A Symposium on Fish Culture A Practical and Comprehensive guide on Inland Fish Farming2015-05-06T20:27:00+00:00 24 MB 
[TXT]Development of Destitute Tribal Communities2015-05-07T17:46:00+00:00 20 MB 
[TXT]Historiography and Historians of Modern India2015-05-08T15:05:00+00:00 18 MB 
[TXT]Analysis of Milk and its Products A Lab Manual 2nd Edition2015-05-09T12:24:00+00:00 18 MB 
[TXT]Abridged Version2015-05-10T09:43:00+00:00 23 MB 
[TXT]Rural Development and Education2015-05-11T07:02:00+00:00 18 MB 
[TXT]India and SAARC Engagements2015-05-12T04:21:00+00:00 24 MB 
[TXT]Dimensions of Women Exploitation2015-05-13T01:40:00+00:00 17 MB 
[TXT]Child Counselling and Education2015-05-13T22:59:00+00:00 23 MB 
[TXT]Role of NGOs in Development of Social System2015-05-14T20:18:00+00:00 24 MB 
[TXT]Encyclopaedia of Ecology, Environment and Pollution Documents and Case Studies2015-05-15T17:37:00+00:00 17 MB 
[TXT]Sufism in India2015-05-16T14:56:00+00:00 22 MB 
[TXT]Hatha-Yoga Its Context, Theory and Practice 1st Edition2015-05-17T12:15:00+00:00 21 MB 
[TXT]Voyages and Travels into Brazil and the East Indies Containing an Exact Description of the Dutch Br2015-05-18T09:34:00+00:00 23 MB 
[TXT]Democratic Administration and Education2015-05-19T06:53:00+00:00 21 MB 
[TXT]Foundations of External Quality Assurance in Indian Higher Education2015-05-20T04:12:00+00:00 20 MB 
[TXT]New Assignment in Journalism2015-05-21T01:31:00+00:00 19 MB 
[TXT]The Marcandeya Purana In The Original Sanskrit2015-05-21T22:50:00+00:00 19 MB 
[TXT]Horticultural Development in Hills A Case for the Alaknanda Basin, Uttaranchal2015-05-22T20:09:00+00:00 21 MB 
[TXT]Dalit, Racism and Social Articulation2015-05-23T17:28:00+00:00 22 MB 
[TXT]Minorities and Social Conflict2015-05-24T14:47:00+00:00 21 MB 
[TXT]Indian Constitution, Government and Politics2015-05-25T12:06:00+00:00 18 MB 
[TXT]The Voyage of Francois Pyrard of Laval To the East Indies, The Maladives The Moluccas and Brazil 2 V2015-05-26T09:25:00+00:00 22 MB 
[TXT]In the Wonderland of Investment Assessment Year 2004-20052015-05-27T06:44:00+00:00 21 MB 
[TXT]The Banishment of Seeta2015-05-28T04:03:00+00:00 23 MB 
[TXT]Scenario of Agriculture in Andhra Pradesh2015-05-29T01:22:00+00:00 22 MB 
[TXT]Saga of Energy, Mind and Numerology2015-05-29T22:41:00+00:00 25 MB 
[TXT]State Politics and Panchayats in India2015-05-30T20:00:00+00:00 25 MB 
[TXT]Bangladesh Army and Contemporary Issues2015-05-31T17:19:00+00:00 20 MB 
[TXT]Bangladesh Society and Change2015-06-01T14:38:00+00:00 21 MB 
[TXT]Intellectuals and Society A Study of Teachers in India2015-06-02T11:57:00+00:00 25 MB 
[TXT]The Upasana-cintamani Wish-Yielding Gem of Meditation2015-06-03T09:16:00+00:00 18 MB 
[TXT]Know Your India2015-06-04T06:35:00+00:00 19 MB 
[TXT]Rural Development in India Approaches and Applications2015-06-05T03:54:00+00:00 23 MB 
[TXT]Mutual Funds In India2015-06-06T01:13:00+00:00 21 MB 
[TXT]Communication and Education for Health Promotion and Population Regulation A Global Perspective2015-06-06T22:32:00+00:00 19 MB 
[TXT]Increasing Role of Technology in Education2015-06-07T19:51:00+00:00 19 MB 
[TXT]Politicisation Of Indian Education2015-06-08T17:10:00+00:00 19 MB 
[TXT]Multicultural Education2015-06-09T14:29:00+00:00 24 MB 
[TXT]The Power of Innovative Thinking Let New Ideas Lead You to Success2015-06-10T11:48:00+00:00 18 MB 
[TXT]India's Elderly A Multidisciplinary Dimension2015-06-11T09:07:00+00:00 22 MB 
[TXT]India Related Naipaul A Study in Art2015-06-12T06:26:00+00:00 18 MB 
[TXT]Maratha Military Systems2015-06-13T03:45:00+00:00 21 MB 
[TXT]Problems of Research in Public Administration2015-06-14T01:04:00+00:00 22 MB 
[TXT]Rural Development Through Cooperatives2015-06-14T22:23:00+00:00 23 MB 
[TXT]Role Conflict Among Women Teachers2015-06-15T19:42:00+00:00 22 MB 
[TXT]Indian Military Legal Systems2015-06-16T17:01:00+00:00 22 MB 
[TXT]Textbook of Inorganic Chemistry2015-06-17T14:20:00+00:00 17 MB 
[TXT]Sustainable Rural Development for Disaster Mitigation2015-06-18T11:39:00+00:00 20 MB 
[TXT]Women Empowerment and Gender Planning2015-06-19T08:58:00+00:00 24 MB 
[TXT]Economic Environment of Business2015-06-20T06:17:00+00:00 19 MB 
[TXT]Elementary Education in 21st Century2015-06-21T03:36:00+00:00 24 MB 
[TXT]Diplomatic Journey Emerging India2015-06-22T00:55:00+00:00 23 MB 
[TXT]Dictionary of Common English2015-06-22T22:14:00+00:00 20 MB 
[TXT]Discover India2015-06-23T19:33:00+00:00 17 MB 
[TXT]Music Information Retrieval2015-06-24T16:52:00+00:00 25 MB 
[TXT]Tribal Villages in Arunachal Pradesh Changing Human Interface2015-06-25T14:11:00+00:00 17 MB 
[TXT]Great Sufi Saints Sarmad and Bawa Muhaiyaddeen2015-06-26T11:30:00+00:00 24 MB 
[TXT]Cosmo Dictionary of Mathematics2015-06-27T08:49:00+00:00 19 MB 
[TXT]The Place of Aphorisms Vol. 1 2nd Revised and Enlarged Edition2015-06-28T06:08:00+00:00 17 MB 
[TXT]Abdul Hameed Ansari Revolutionary Journalist and Freedom Fighter2015-06-29T03:27:00+00:00 18 MB 
[TXT]Environmental Crisis and Techno-Economic Alternatives2015-06-30T00:46:00+00:00 20 MB 
[TXT]Indian Kavya Literature2015-06-30T22:05:00+00:00 17 MB 
[TXT]Changing Trends in Strategic Management2015-07-01T19:24:00+00:00 17 MB 
[TXT]Economics of Floriculture2015-07-02T16:43:00+00:00 19 MB 
[TXT]Globalisation or Colonisation?2015-07-03T14:02:00+00:00 24 MB 
[TXT]Factions in Northern Rural India2015-07-04T11:21:00+00:00 24 MB 
[TXT]The Failure of Lord Cuzon A Study in "Imperialism&a2015-07-05T08:40:00+00:00 20 MB 
[TXT]The Clash of Ideologies Middle Eastern Politics and American Security2015-07-06T05:59:00+00:00 24 MB 
[TXT]Archbold Criminal Pleading, Evidence and Practice 2012 60th Edition, Full Print + Supplements2015-07-07T03:18:00+00:00 19 MB 
[TXT]The Works of Alain Locke2015-07-08T00:37:00+00:00 25 MB 
[TXT]The Oxford Handbook of Thomas Middleton2015-07-08T21:56:00+00:00 24 MB 
[TXT]A Tale of Things Timeless2015-07-09T19:15:00+00:00 25 MB 
[TXT]Political Alienation in Libya Assessing Citizens Political Attitude and Behaviour2015-07-10T16:34:00+00:00 18 MB 
[TXT]Eve Templar 12015-07-11T13:53:00+00:00 19 MB 
[TXT]Thief of Shadows2015-07-12T11:12:00+00:00 22 MB 
[TXT]God With Us2015-07-13T08:31:00+00:00 25 MB 
[TXT]To the Last Breath A Memoir of Going to Extremes Illustrated Edition2015-07-14T05:50:00+00:00 22 MB 
[TXT]Shakespeare in America2015-07-15T03:09:00+00:00 18 MB 
[TXT]On Oligarchy Ancient Lessons for Global Politics2015-07-16T00:28:00+00:00 22 MB 
[TXT]Breaking Ice for Arctic Oil The Epic Voyage of the SS Manhattan Through the Northwest Passage2015-07-16T21:47:00+00:00 23 MB 
[TXT]Polanski and Perception The Psychology of Seeing and the Cinema of Roman Polanski2015-07-17T19:06:00+00:00 18 MB 
[TXT]The Emotional Wellness Way to Cardiac Health How Letting Go of Depression, Anxiety &2015-07-18T16:25:00+00:00 22 MB 
[TXT]Getting Children Back to School Case Studies in Primary Education 1st Edition2015-07-19T13:44:00+00:00 17 MB 
[TXT]The Invincible Deadly Mosquitoes2015-07-20T11:03:00+00:00 17 MB 
[TXT]Jaina Worship and Rituals Ancient and Medieval India2015-07-21T08:22:00+00:00 25 MB 
[TXT]Governance in India A Theatre of the Absurd2015-07-22T05:41:00+00:00 20 MB 
[TXT]Indian Constitution Government and Political System2015-07-23T03:00:00+00:00 25 MB 
[TXT]Organic Compounds2015-07-24T00:19:00+00:00 25 MB 
[TXT]Organic Synthesis2015-07-24T21:38:00+00:00 21 MB 
[TXT]Vision of Raja Rammohun Roy Secularism, Humanism, Universalism2015-07-25T18:57:00+00:00 21 MB 
[TXT]Water and Waste Water Management2015-07-26T16:16:00+00:00 23 MB 
[TXT]Indian Ocean Rim-Association for Regional Cooperation Problems and Prospects 1st Edition2015-07-27T13:35:00+00:00 25 MB 
[TXT]Environmental Security Concept and Dimensions2015-07-28T10:54:00+00:00 22 MB 
[TXT]Administration and Management of NGOs Text and Case Studies2015-07-29T08:13:00+00:00 20 MB 
[TXT]Management of State Tourism Development Corporations2015-07-30T05:32:00+00:00 19 MB 
[TXT]Moulds Design and Processing Hand Book The Book Covers Complete Details of Mould Design and Processi2015-07-31T02:51:00+00:00 21 MB 
[TXT]Guide to Wellness and Well-Being2015-08-01T00:10:00+00:00 20 MB 
[TXT]Paint Varnish Solvents and Coating Technology 2nd Edition2015-08-01T21:29:00+00:00 21 MB 
[TXT]Hand Book of Adhesives With Their Formulaes : With Directory of Manufacturers/Suppliers of Plant, Eq2015-08-02T18:48:00+00:00 25 MB 
[TXT]A Personal Narrative of a Visit to Ghuzni, Kabul, and Afghanistan, and of a Residence at the Court2015-08-03T16:07:00+00:00 25 MB 
[TXT]Caste System in India2015-08-04T13:26:00+00:00 23 MB 
[TXT]Evaluation of Educational Research2015-08-05T10:45:00+00:00 19 MB 
[TXT]Studies in Women Writers in English2015-08-06T08:04:00+00:00 21 MB 
[TXT]Mental Retardation and Social Responsibility2015-08-07T05:23:00+00:00 20 MB 
[TXT]Migration and Migrants2015-08-08T02:42:00+00:00 20 MB 
[TXT]Career Information and Guidance and Counselling2015-08-09T00:01:00+00:00 21 MB 
[TXT]Diseases of Crop-Plants2015-08-09T21:20:00+00:00 18 MB 
[TXT]Complete Book on Pregnancy and Child Birth2015-08-10T18:39:00+00:00 22 MB 
[TXT]Modern Trends in Indian Education 2nd Revised and Enlarged Edition2015-08-11T15:58:00+00:00 19 MB 
[TXT]Cricket The Essentials of the Game2015-08-12T13:17:00+00:00 24 MB 
[TXT]History and Theory of Public Administration2015-08-13T10:36:00+00:00 19 MB 
[TXT]War of Liberation in Bangladesh 1st Edition2015-08-14T07:55:00+00:00 25 MB 
[TXT]Hillary Rodham Clinton: Polarizing First Lady (Modern First Ladies)2015-08-15T05:14:00+00:00 21 MB 
[TXT]The Arthur of the English: The Arthurian Legend in English Life and Literature (University of Wales2015-08-16T02:33:00+00:00 17 MB 
[TXT]On Loving Our Enemies Essays in Moral Psychology2015-08-16T23:52:00+00:00 24 MB 
[TXT]The Laundry Man2015-08-17T21:11:00+00:00 17 MB 
[TXT]The Rehearsal Pigeon Theatres Trilogy of Performance Works on Playing Dead2015-08-18T18:30:00+00:00 22 MB 
[TXT]Historical Environmental Variation in Conservation and Natural Resource Management2015-08-19T15:49:00+00:00 19 MB 
[TXT]The Intellectual and His People, Vol. 2 Staging the People2015-08-20T13:08:00+00:00 23 MB 
[TXT]God Without Being Hors-Texte2015-08-21T10:27:00+00:00 19 MB 
[TXT]A Cultural History of Heredity2015-08-22T07:46:00+00:00 23 MB 
[TXT]The Rhyming Rabbit, 12015-08-23T05:05:00+00:00 23 MB 
[TXT]Perspectives of Hotel Management 1st Edition2015-08-24T02:24:00+00:00 17 MB 
[TXT]2010 IEEE International Symposium on Precision Clock Synchronization for Measurement, Control and C2015-08-24T23:43:00+00:00 19 MB 
[TXT]Islamic Food with Healing Touch2015-08-25T21:02:00+00:00 20 MB 
[TXT]2010 IEEE 18th International Workshop on Quality of Service (IWQoS 2010) Proceedings of a Meeting h2015-08-26T18:21:00+00:00 24 MB 
[TXT]Black Stars African American Women Scientists and Inventors2015-08-27T15:40:00+00:00 25 MB 
[TXT]2010 3rd International Symposium on Systems and Control in Aeronautics and Astronautics (ISSCAA 2012015-08-28T12:59:00+00:00 20 MB 
[TXT]13th International Conference on Aluminum Alloys ICAA 132015-08-29T10:18:00+00:00 19 MB 
[TXT]Management Text and Cases 2nd Edition2015-08-30T07:37:00+00:00 20 MB 
[TXT]AIEEE Mathematics As Per New Pattern of Examinations2015-08-31T04:56:00+00:00 17 MB 
[TXT]Covent Garden The Fruit, Vegetable and Flower Markets2015-09-01T02:15:00+00:00 20 MB 
[TXT]Play Guitar With...Black Sabbath2015-09-01T23:34:00+00:00 18 MB 
[TXT]Ecotoxicology and Environmental Health2015-09-02T20:53:00+00:00 17 MB 
[TXT]The Handbook of Global Health Communication2015-09-03T18:12:00+00:00 18 MB 
[TXT]Naxalism At a Glance2015-09-04T15:31:00+00:00 19 MB 
[TXT]The Art of Mythical Composition and Narration Dagara White Bagr2015-09-05T12:50:00+00:00 18 MB 
[TXT]Direct Taxes Ready Reckoner with Tax Planning For A.Y. 2012-2013 & 2013-20142015-09-06T10:09:00+00:00 18 MB 
[TXT]Charity and Philanthropy for Dummies2015-09-07T07:28:00+00:00 24 MB 
[TXT]Dynamic Memory Modern Paragraph Writing : Secondary Level2015-09-08T04:47:00+00:00 18 MB 
[TXT]Unspeakable Anecdotes My Life, Judiciary and More....2015-09-09T02:06:00+00:00 21 MB 
[TXT]The Engineering Train2015-09-09T23:25:00+00:00 21 MB 
[TXT]Tissue and Cell Clinical Use An Essential Guide2015-09-10T20:44:00+00:00 18 MB 
[TXT]Contemporary Quilts: Design, Surface and Stitch2015-09-11T18:03:00+00:00 23 MB 
[TXT]Encyclopaedia of Comparative Government and Select Constitutions 3 Vols.2015-09-12T15:22:00+00:00 19 MB 
[TXT]Asymmetric Synthesis of Natural Products2015-09-13T12:41:00+00:00 23 MB 
[TXT]History of Economic Thought2015-09-14T10:00:00+00:00 18 MB 
[TXT]Household and Family Religion in Antiquity2015-09-15T07:19:00+00:00 25 MB 
[TXT]The Rise of Kundalini A Practical Adviser2015-09-16T04:38:00+00:00 17 MB 
[TXT]An Introduction to Distance Measurement in Astronomy2015-09-17T01:57:00+00:00 19 MB 
[TXT]Japa and Dhyana in a Nutshell2015-09-17T23:16:00+00:00 22 MB 
[TXT]Palliative and End of Life Care for Children and Young People Home, Hospice, Hospital2015-09-18T20:35:00+00:00 23 MB 
[TXT]Improving Agricultural Education Concept and Methods2015-09-19T17:54:00+00:00 17 MB 
[TXT]The Rise of Middle Classes in Manipur2015-09-20T15:13:00+00:00 22 MB 
[TXT]Money and Banking in India2015-09-21T12:32:00+00:00 20 MB 
[TXT]Organizational Behaviour and Design2015-09-22T09:51:00+00:00 21 MB 
[TXT]Pentacles One Long Short Story and Four Long Story Poems in Free Verse2015-09-23T07:10:00+00:00 22 MB 
[TXT]Writing Politics Left Discourses in Contemporary India 1st Reprint2015-09-24T04:29:00+00:00 21 MB 
[TXT]Uttara-Kanda Vol. 42015-09-25T01:48:00+00:00 21 MB 
[TXT]Studies in Occultism 1st Indian Edition2015-09-25T23:07:00+00:00 24 MB 
[TXT]Rgveda Hymns and Ancient Thought Vol. 1 1st Published2015-09-26T20:26:00+00:00 25 MB 
[TXT]Punjab Today2015-09-27T17:45:00+00:00 24 MB 
[TXT]Stories from Bhaagavatham 1st Edition2015-09-28T15:04:00+00:00 21 MB 
[TXT]Understanding Communication Skills2015-09-29T12:23:00+00:00 17 MB 
[TXT]Regulation of Financial Intermediaries in Emerging Markets2015-09-30T09:42:00+00:00 24 MB 
[TXT]Productivity Techniques An Insight into Flow Manufacturing2015-10-01T07:01:00+00:00 25 MB 
[TXT]Teacher Commitment2015-10-02T04:20:00+00:00 17 MB 
[TXT]Test and Measurement in Education2015-10-03T01:39:00+00:00 22 MB 
[TXT]Death Penalty2015-10-03T22:58:00+00:00 19 MB 
[TXT]Teaching of Political Science2015-10-04T20:17:00+00:00 20 MB 
[TXT]Role Multiplicity of Lower Middle Class Working Women2015-10-05T17:36:00+00:00 23 MB 
[TXT]Environmental Degradation of Jammu and Kashmir Himalayas and their Control2015-10-06T14:55:00+00:00 18 MB 
[TXT]Regional Movements, Ethnicity and Politics2015-10-07T12:14:00+00:00 25 MB 
[TXT]Brahmasutram Srimadbrahmasutratadbhasyasahitayamtattvaprakasikayam2015-10-08T09:33:00+00:00 21 MB 
[TXT]Encyclopaedic Dictionary of Biology2015-10-09T06:52:00+00:00 25 MB 
[TXT]Environmental Issues and Challenges2015-10-10T04:11:00+00:00 17 MB 
[TXT]Environment Protection and Development Emerging Issues, Reforms and Strategies2015-10-11T01:30:00+00:00 21 MB 
[TXT]Old Maps and New Legacies of the Partition : A Pakistan Diary2015-10-11T22:49:00+00:00 21 MB 
[TXT]Psycho-social Aspects of Sports2015-10-12T20:08:00+00:00 19 MB 
[TXT]Teaching of Physical Science2015-10-13T17:27:00+00:00 25 MB 
[TXT]History of Modern China and Japan (1840-1950)2015-10-14T14:46:00+00:00 19 MB 
[TXT]Young Designers, 20022015-10-15T12:05:00+00:00 23 MB 
[TXT]A Text Book of Swasthavritta2015-10-16T09:24:00+00:00 20 MB 
[TXT]Dictionary of New Words2015-10-17T06:43:00+00:00 19 MB 
[TXT]Italian Renaissance Painting Colour Library2015-10-18T04:02:00+00:00 19 MB 
[TXT]Classic Art An Introduction to the Italian Renaissance2015-10-19T01:21:00+00:00 25 MB 
[TXT]Gothic Revival Art and Ideas2015-10-19T22:40:00+00:00 25 MB 
[TXT]Monet Art and Ideas2015-10-20T19:59:00+00:00 20 MB 
[TXT]Christian Boltanski2015-10-21T17:18:00+00:00 25 MB 
[TXT]Van Gogh's Flowers2015-10-22T14:37:00+00:00 21 MB 
[TXT]Emerging Religious Identities of Arunachal Pradesh A Study of Nyishi Tribe2015-10-23T11:56:00+00:00 17 MB 
[TXT]Critical Theory Perspectives from Asia2015-10-24T09:15:00+00:00 21 MB 
[TXT]History of Dalits2015-10-25T06:34:00+00:00 23 MB 
[TXT]The Earl of Auckland And the First Afghan War2015-10-26T03:53:00+00:00 18 MB 
[TXT]International Encyclopaedia of School Education2015-10-27T01:12:00+00:00 23 MB 
[TXT]History of Journalism For PG Diploma and Degree Courses in Journalism and Mass Media2015-10-27T22:31:00+00:00 19 MB 
[TXT]Empowering of Rural Workers Dynamics of Strategic Interventions, Experiments and Outcomes2015-10-28T19:50:00+00:00 18 MB 
[TXT]Gender Dynamics in Water Security A Study in Rajasthan2015-10-29T17:09:00+00:00 19 MB 
[TXT]Computer System Development2015-10-30T14:28:00+00:00 17 MB 
[TXT]Documents2015-10-31T11:47:00+00:00 19 MB 
[TXT]India and Her Neighbourhood A French Observer&am2015-11-01T09:06:00+00:00 18 MB 
[TXT]Kirwant2015-11-02T06:25:00+00:00 19 MB 
[TXT]Encyclopedia of Science Projects2015-11-03T03:44:00+00:00 21 MB 
[TXT]Comparative Politics A Critique2015-11-04T01:03:00+00:00 18 MB 
[TXT]Mensa Guide to Chess 30 Days to Great Chess2015-11-04T22:22:00+00:00 20 MB 
[TXT]Research Methodology Modified Syllabus of Indian Universities/B.Ed. Training Institutes and College2015-11-05T19:41:00+00:00 20 MB 
[TXT]Islam's Big no to Terrorism Friendship with All Malice for None2015-11-06T17:00:00+00:00 21 MB 
[TXT]Medherb Green Pages : India and Pakistan - 2005 A Handbook of Authentic Updated Information on Indi2015-11-07T14:19:00+00:00 18 MB 
[TXT]Assam-Medieval and Modem History2015-11-08T11:38:00+00:00 25 MB 
[TXT]The Warrior and the Charioteer A Materialist Interpretation of the Bhagavadgita, Including a New Tra2015-11-09T08:57:00+00:00 21 MB 
[TXT]Academic Library System2015-11-10T06:16:00+00:00 22 MB 
[TXT]Nuclear Power and Non-Proliferation Conflict or Convergence?2015-11-11T03:35:00+00:00 25 MB 
[TXT]Sriramacaritabdhiratna of Nityananda Shastri2015-11-12T00:54:00+00:00 18 MB 
[TXT]The Strawberry2015-11-12T22:13:00+00:00 18 MB 
[TXT]The Vakataka Heritage Indian Culture at the Crossroads2015-11-13T19:32:00+00:00 25 MB 
[TXT]Pakistan Nation, Nationalism and the State2015-11-14T16:51:00+00:00 24 MB 
[TXT]Administration and Training of Educational and Vocational Guidance2015-11-15T14:10:00+00:00 23 MB 
[TXT]Dimensions of Social Research2015-11-16T11:29:00+00:00 17 MB 
[TXT]British Reforms, Conquests and Expansion, 1807-18572015-11-17T08:48:00+00:00 19 MB 
[TXT]Pakistan's Foreign Policy2015-11-18T06:07:00+00:00 25 MB 
[TXT]Stopped in Our Tracks Stories of U.G. in India2015-11-19T03:26:00+00:00 19 MB 
[TXT]The Complete Technology Book on Pulp and Paper Industries2015-11-20T00:45:00+00:00 20 MB 
[TXT]Academic Dictionary of Electronics2015-11-20T22:04:00+00:00 22 MB 
[TXT]Academic Dictionary of Philosophy2015-11-21T19:23:00+00:00 18 MB 
[TXT]Scientific Methods2015-11-22T16:42:00+00:00 19 MB 
[TXT]Indian Political System Structures, Policy & Development2015-11-23T14:01:00+00:00 25 MB 
[TXT]The Masnavi2015-11-24T11:20:00+00:00 19 MB 
[TXT]An Essence of Biotechnology2015-11-25T08:39:00+00:00 20 MB 
[TXT]Academic Dictionary of Science2015-11-26T05:58:00+00:00 23 MB 
[TXT]Public Relations in India 1st Edition2015-11-27T03:17:00+00:00 19 MB 
[TXT]Encyclopaedia of Geomorphology2015-11-28T00:36:00+00:00 18 MB 
[TXT]Encyclopaedia of Social Problems and Social Welfare2015-11-28T21:55:00+00:00 17 MB 
[TXT]The Laghusiddhanta Kaumudi Text with English Translation2015-11-29T19:14:00+00:00 21 MB 
[TXT]Analysis of Great Philosophers2015-11-30T16:33:00+00:00 21 MB 
[TXT]Panchatantram Aparikshitakarakam : According to CCIM Syllabus2015-12-01T13:52:00+00:00 20 MB 
[TXT]Tarkabhasa of Srikesava Misra With the Commentary Prakasa of Govardhana2015-12-02T11:11:00+00:00 24 MB 
[TXT]Space Woman Kalpana Chawla An Exclusive Biography of a Great Indian Woman Astronaut who Achieved Ra2015-12-03T08:30:00+00:00 21 MB 
[TXT]Modern Encyclopaedia of Secondary Education2015-12-04T05:49:00+00:00 23 MB 
[TXT]Impact of Internet on Journalism2015-12-05T03:08:00+00:00 22 MB 
[TXT]Folk Tales of Manipur2015-12-06T00:27:00+00:00 23 MB 
[TXT]Fundamentals of Political Sociology2015-12-06T21:46:00+00:00 21 MB 
[TXT]Sustainable Agriculture Issues in Production, Management, Agronomy and ICT Applications2015-12-07T19:05:00+00:00 24 MB 
[TXT]Sacred Tales of India2015-12-08T16:24:00+00:00 24 MB 
[TXT]The Bureaucratic Ascendancy Public Administration in Bangladesh the First Three Decades2015-12-09T13:43:00+00:00 24 MB 
[TXT]The Ramayana An Epic Play in Four Acts2015-12-10T11:02:00+00:00 22 MB 
[TXT]Transformation Through the People, for the People2015-12-11T08:21:00+00:00 20 MB 
[TXT]The Study of the Quran by Non-Muslim Indian Scholars2015-12-12T05:40:00+00:00 22 MB 
[TXT]Writing Difference The Novels of Shashi Deshpande2015-12-13T02:59:00+00:00 25 MB 
[TXT]A Lick of The Spoon Big Book New Edition2015-12-14T00:18:00+00:00 18 MB 
[TXT]Another Cinema for Another Society2015-12-14T21:37:00+00:00 23 MB 
[TXT]Media and Mediation2015-12-15T18:56:00+00:00 19 MB 
[TXT]Muslim League in N.W.F.P2015-12-16T16:15:00+00:00 24 MB 
[TXT]Hockey Skills and Rules2015-12-17T13:34:00+00:00 21 MB 
[TXT]Riding the Nuclear Tiger2015-12-18T10:53:00+00:00 17 MB 
[TXT]Applied Mechanics and Strength of Materials A Textbook for the Students of U.P.S.C. (Engg. Service)2015-12-19T08:12:00+00:00 24 MB 
[TXT]Bangladesh The Next Afghanistan?2015-12-20T05:31:00+00:00 23 MB 
[TXT]Art Today2015-12-21T02:50:00+00:00 21 MB 
[TXT]Renzo Piano Building Workshop, Vol. 22015-12-22T00:09:00+00:00 18 MB 
[TXT]Van Gogh A&I2015-12-22T21:28:00+00:00 18 MB 
[TXT]The Garden Book Mini Edition2015-12-23T18:47:00+00:00 22 MB 
[TXT]Yes.. Mr. Finance Minister! How Indian Finance Ministers Missed Out on Unlocking the Nation&apos2015-12-24T16:06:00+00:00 19 MB 
[TXT]Ambedkar Code of Conduct2015-12-25T13:25:00+00:00 22 MB 
[TXT]Art of Dancing Classical and Folk Dances2015-12-26T10:44:00+00:00 20 MB 
[TXT]Colonializing Agriculture They Myth of Punjab Exceptionalism2015-12-27T08:03:00+00:00 25 MB 
[TXT]Management of Physical Education and Sports2015-12-28T05:22:00+00:00 24 MB 
[TXT]Contemporary English Grammar for Scholars and Students2015-12-29T02:41:00+00:00 18 MB 
[TXT]Comprehensive High School English Grammar and Composition2015-12-30T00:00:00+00:00 20 MB 
[TXT]The Effective Presentation Talk Your Way to Success2015-12-30T21:19:00+00:00 22 MB 
[TXT]Races of Afghanistan2015-12-31T18:38:00+00:00 23 MB 
[TXT]Shaping Organisational Strategies Future Perspectives Concepts and Cases2016-01-01T15:57:00+00:00 19 MB 
[TXT]Current Problems in World Higher Education2016-01-02T13:16:00+00:00 22 MB 
[TXT]How to Coach Boxing2016-01-03T10:35:00+00:00 19 MB 
[TXT]Teach Yourself Women Gymnastics2016-01-04T07:54:00+00:00 25 MB 
[TXT]International Tourism Development2016-01-05T05:13:00+00:00 21 MB 
[TXT]Foundation of Physical Education2016-01-06T02:32:00+00:00 23 MB 
[TXT]Globalizing Democracy and Human Rights2016-01-06T23:51:00+00:00 17 MB 
[TXT]Managing Safety Challenges Ahead Safety and Hazard Control2016-01-07T21:10:00+00:00 25 MB 
[TXT]Mass with Children2016-01-08T18:29:00+00:00 23 MB 
[TXT]Modern Methods of Teaching Language2016-01-09T15:48:00+00:00 24 MB 
[TXT]Gardens of the Great Mughals Reprint London 1913 Edition2016-01-10T13:07:00+00:00 25 MB 
[TXT]Supreme Court and High Court Judgements Relating to Women and Children2016-01-11T10:26:00+00:00 25 MB 
[TXT]Poverty, Globalisation and Human Development2016-01-12T07:45:00+00:00 17 MB 
[TXT]Fishery Management2016-01-13T05:04:00+00:00 19 MB 
[TXT]Dimensions of Researches in Indian Anthropology2016-01-14T02:23:00+00:00 24 MB 
[TXT]Typology and Universals2016-01-14T23:42:00+00:00 17 MB 
[TXT]Jawahar Lal Nehru2016-01-15T21:01:00+00:00 19 MB 
[TXT]Thoughts2016-01-16T18:20:00+00:00 21 MB 
[TXT]Religion2016-01-17T15:39:00+00:00 17 MB 
[TXT]Urban Centers of Pondicherry2016-01-18T12:58:00+00:00 24 MB 
[TXT]World Famous Personalities Know the Great Minds of the World2016-01-19T10:17:00+00:00 18 MB 
[TXT]The Cambridge Companion to English Renaissance Drama2016-01-20T07:36:00+00:00 18 MB 
[TXT]Alex Katz Contemporary Artists2016-01-21T04:55:00+00:00 21 MB 
[TXT]Francesca Woodman2016-01-22T02:14:00+00:00 19 MB 
[TXT]Sempe Everything is Complicated2016-01-22T23:33:00+00:00 19 MB 
[TXT]Julia Margaret Cameron2016-01-23T20:52:00+00:00 19 MB 
[TXT]Wallpaper* City Guide Osaka (Wallpaper City Guides)2016-01-24T18:11:00+00:00 19 MB 
[TXT]The Younger than Jesus Artist Directory2016-01-25T15:30:00+00:00 17 MB 
[TXT]Noma Time and Place in Nordic Cuisine2016-01-26T12:49:00+00:00 20 MB 
[TXT]Quick And Clever Felting2016-01-27T10:08:00+00:00 25 MB 
[TXT]Irish Literature The Eighteenth Century2016-01-28T07:27:00+00:00 20 MB 
[TXT]Discovering Psychology, Study Guide & Scientific American Reader for Hockenb2016-01-29T04:46:00+00:00 23 MB 
[TXT]Galatea and Midas John Lyly2016-01-30T02:05:00+00:00 18 MB 
[TXT]Physics of Semiconductors 29th International Conference on the Physics of Semiconductors2016-01-30T23:24:00+00:00 18 MB 
[TXT]Microsoft SQL Server 2008 Internals (Pro - Developer)2016-01-31T20:43:00+00:00 17 MB 
[TXT]Microsoft Outlook 2010 Inside Out2016-02-01T18:02:00+00:00 25 MB 
[TXT]Coaching Youth Volleyball 4th Edition2016-02-02T15:21:00+00:00 18 MB 
[TXT]Dazzling Dresses2016-02-03T12:40:00+00:00 19 MB 
[TXT]Sarcosuchus Imperator (Discovering Dinosaurs)2016-02-04T09:59:00+00:00 23 MB 
[TXT]Long Road to Freedom: Journey of the Hmong (High Five Reading)2016-02-05T07:18:00+00:00 17 MB 
[TXT]Clara Barton Angel of the Battlefield2016-02-06T04:37:00+00:00 21 MB 
[TXT]Martin Luther King, Jr. Great Civil Rights Leader2016-02-07T01:56:00+00:00 25 MB 
[TXT]Beneath His Wings: Abiding in God's Comfort and Love2016-02-07T23:15:00+00:00 17 MB 
[TXT]How to Study Your Bible for Kids (Discover 4 Yourself® Inductive Bible Studies for Kids)2016-02-08T20:34:00+00:00 18 MB 
[TXT]Overcoming Fear and Discouragement: Ezra, Nehemiah, Esther (The New Inductive Study Series)2016-02-09T17:53:00+00:00 19 MB 
[TXT]Grandma, Do You Remember When?: Sharing a Lifetime of Loving Memories--A Keepsake Journal2016-02-10T15:12:00+00:00 18 MB 
[TXT]Discover the Bible for Yourself: *Helpful introductions to every book *Practical approaches for stu2016-02-11T12:31:00+00:00 19 MB 
[TXT]Becoming the Woman of His Dreams: Seven Qualities Every Man Longs For2016-02-12T09:50:00+00:00 24 MB 
[TXT]Loving God with All Your Mind Growth and Study Guide (Growth and Study Guides)2016-02-13T07:09:00+00:00 24 MB 
[TXT]Breaking the Worry Habit...Forever!: Gods Plan for Lasting Peace of Mind2016-02-14T04:28:00+00:00 25 MB 
[TXT]A Marriage Without Regrets: No matter where you are or where youve been, you can have2016-02-15T01:47:00+00:00 24 MB 
[TXT]Finding the Right One for You: Secrets to Recognizing Your Perfect Mate2016-02-15T23:06:00+00:00 20 MB 
[TXT]Where Grace Abides (The Riverhaven Years)2016-02-16T20:25:00+00:00 18 MB 
[TXT]The Amazing Claims of Bible Prophecy: What You Need to Know in These Uncertain Times2016-02-17T17:44:00+00:00 22 MB 
[TXT]Sassy, Single, and Satisfied: Secrets to Loving the Life Youre Living2016-02-18T15:03:00+00:00 21 MB 
[TXT]You Can Do Tea2016-02-19T12:22:00+00:00 23 MB 
[TXT]Quiet Time Moments for Women2016-02-20T09:41:00+00:00 20 MB 
[TXT]Pollution (Writing the Critical Essay)2016-02-21T07:00:00+00:00 25 MB 
[TXT]Bioisosteres in Medicinal Chemistry2016-02-22T04:19:00+00:00 21 MB 
[TXT]Sia2016-02-23T01:38:00+00:00 22 MB 
[TXT]Illustrated Classic Series Oliver Twist2016-02-23T22:57:00+00:00 20 MB 
[TXT]Illustrated World Classics A Connecticut Yankee in King Arthur's Court2016-02-24T20:16:00+00:00 21 MB 
[TXT]A+Manager DNA Decoded2016-02-25T17:35:00+00:00 22 MB 
[TXT]Proton Exchange Membrane Fuel Cells Modeling2016-02-26T14:54:00+00:00 17 MB 
[TXT]Love Destination Unknown2016-02-27T12:13:00+00:00 17 MB 
[TXT]Time and her Little Sister2016-02-28T09:32:00+00:00 22 MB 
[TXT]Career and Working on Cruise2016-02-29T06:51:00+00:00 17 MB 
[TXT]Glimpses of Vedic Literature 1st Edition2016-03-01T04:10:00+00:00 17 MB 
[TXT]Latest Shayari SMS2016-03-02T01:29:00+00:00 20 MB 
[TXT]Menace of Crime in India Issues and Challenges2016-03-02T22:48:00+00:00 17 MB 
[TXT]Problems and Solutions in Engineering Mathematics2016-03-03T20:07:00+00:00 19 MB 
[TXT]Economic Liberalization Effects and Challenges 1st Edition2016-03-04T17:26:00+00:00 18 MB 
[TXT]Sustainability and Economic Development in Hill Agriculture2016-03-05T14:45:00+00:00 17 MB 
[TXT]Disaster Management and Economic Development2016-03-06T12:04:00+00:00 25 MB 
[TXT]Sustainable Refurbishment2016-03-07T09:23:00+00:00 25 MB 
[TXT]Environmental Hazards and Disasters Contexts, Perspectives and Management2016-03-08T06:42:00+00:00 25 MB 
[TXT]Art and Architecture of Post-Gupta Period Central India2016-03-09T04:01:00+00:00 24 MB 
[TXT]Handbook of Joint Disorders Arthroscopy and Pathology 1st Edition2016-03-10T01:20:00+00:00 17 MB 
[TXT]Numerical Techniques in C2016-03-10T22:39:00+00:00 23 MB 
[TXT]Learn Advanced HTML 4.0 with DHTML2016-03-11T19:58:00+00:00 18 MB 
[TXT]Encyclopaedia of Plant Pathology2016-03-12T17:17:00+00:00 17 MB 
[TXT]Theft of Brinjal2016-03-13T14:36:00+00:00 25 MB 
[TXT]Optical Imaging and Metrology2016-03-14T11:55:00+00:00 24 MB 
[TXT]United Nations (Opposing Viewpoints)2016-03-15T09:14:00+00:00 23 MB 
[TXT]English Language Learners (Issues That Concern You)2016-03-16T06:33:00+00:00 18 MB 
[TXT]The Loch Ness Monster (Monsters)2016-03-17T03:52:00+00:00 23 MB 
[TXT]Mount Olive2016-03-18T01:11:00+00:00 17 MB 
[TXT]Windows Server 2008 Administrator&a2016-03-18T22:30:00+00:00 19 MB 
[TXT]Del Mar Fairgrounds2016-03-19T19:49:00+00:00 20 MB 
[TXT]Lafayette (CA) (Images of America)2016-03-20T17:08:00+00:00 17 MB 
[TXT]Indigenous Knowledge Traditions Perspective from North East India2016-03-21T14:27:00+00:00 19 MB 
[TXT]Optical Materials in Defence Systems Technology IV2016-03-22T11:46:00+00:00 23 MB 
[TXT]Guided Meditation2016-03-23T09:05:00+00:00 22 MB 
[TXT]Flash Professional CS5 Training Guide2016-03-24T06:24:00+00:00 20 MB 
[TXT]Imagining Alternatives2016-03-25T03:43:00+00:00 17 MB 
[TXT]Clean Energy Option & Nuclear Safety An Indian Perspectives2016-03-26T01:02:00+00:00 20 MB 
[TXT]Literary Journey of English Poetry Critical Analysis in Trends Style and Diction 2 Vols.2016-03-26T22:21:00+00:00 23 MB 
[TXT]Practical Holography Includes Proceedings Vols. 0120, 1051, 1212, 1461, 1667, 1914, 2176, 2406, 26522016-03-27T19:40:00+00:00 24 MB 
[TXT]The Buffalo & the Monkey2016-03-28T16:59:00+00:00 21 MB 
[TXT]Understanding Financial Market & Its Segregation2016-03-29T14:18:00+00:00 18 MB 
[TXT]Modern Television Circuits Vol. 102016-03-30T11:37:00+00:00 18 MB 
[TXT]Spikes of Deep Silence by Silence and in Silence2016-03-31T08:56:00+00:00 23 MB 
[TXT]The Goatherd and the Goats / Sour Grapes2016-04-01T06:15:00+00:00 17 MB 
[TXT]Performance2016-04-02T03:34:00+00:00 25 MB 
[TXT]Encyclopedia of World Religions 14. Vols2016-04-03T00:53:00+00:00 25 MB 
[TXT]Fair Trade for All How Trade Can Promote Development2016-04-03T22:12:00+00:00 25 MB 
[TXT]Decisions under Uncertainty Probabilistic Analysis for Engineering Decisions2016-04-04T19:31:00+00:00 23 MB 
[TXT]Women's Health A Complete Guide2016-04-05T16:50:00+00:00 22 MB 
[TXT]Snacks2016-04-06T14:09:00+00:00 23 MB 
[TXT]Quality Management2016-04-07T11:28:00+00:00 23 MB 
[TXT]Training Tact2016-04-08T08:47:00+00:00 18 MB 
[TXT]My Own Khajuraho2016-04-09T06:06:00+00:00 21 MB 
[TXT]Computer Dictionary2016-04-10T03:25:00+00:00 25 MB 
[TXT]Sacred Bowl2016-04-11T00:44:00+00:00 21 MB 
[TXT]Puzzle Pad 212016-04-11T22:03:00+00:00 24 MB 
[TXT]Puzzles Pad 222016-04-12T19:22:00+00:00 18 MB 
[TXT]Teaching of Social Science for the 21st Century2016-04-13T16:41:00+00:00 18 MB 
[TXT]Assimilation of Remote Sensing and In Situ Data in Modern Numerical Weather and Environmental Predic2016-04-14T14:00:00+00:00 22 MB 
[TXT]Fluctuations and Noise in Materials II2016-04-15T11:19:00+00:00 24 MB 
[TXT]Modern Colour TV Circuits, Vol. XVIII 1st Edition2016-04-16T08:38:00+00:00 22 MB 
[TXT]Book-42016-04-17T05:57:00+00:00 19 MB 
[TXT]Digest-52016-04-18T03:16:00+00:00 20 MB 
[TXT]F1 Get the Most out of Excel The Ultimate Excel Tip Help Guide for all Levels Excel 97, 2000, 2002,2016-04-19T00:35:00+00:00 17 MB 
[TXT]Maharana Partap2016-04-19T21:54:00+00:00 25 MB 
[TXT]Mughlai Dishes2016-04-20T19:13:00+00:00 25 MB 
[TXT]Revisiting Indian Literature2016-04-21T16:32:00+00:00 21 MB 
[TXT]Modern Speed Maths2016-04-22T13:51:00+00:00 21 MB 
[TXT]Spatial Information Technology for Natural Resource Management2016-04-23T11:10:00+00:00 23 MB 
[TXT]Media Literacy Project for Pre-University Students2016-04-24T08:29:00+00:00 22 MB 
[TXT]The Bat / The Dog and the Thief2016-04-25T05:48:00+00:00 17 MB 
[TXT]Freedom Movement in Rayalaseema A Study of Peoples Response to the Major Phases of National Movement2016-04-26T03:07:00+00:00 22 MB 
[TXT]India's Policy Towards Sri Lanka Current Issues and Challenges2016-04-27T00:26:00+00:00 24 MB 
[TXT]Best of Bible stories Old Testament2016-04-27T21:45:00+00:00 18 MB 
[TXT]Smart Talk The Public Speakers Guide to Professional Success Unabridged Edition2016-04-28T19:04:00+00:00 19 MB 
[TXT]Communication Skills for Hospitality Management Objective Type Questions and Answers2016-04-29T16:23:00+00:00 18 MB 
[TXT]Simha the Lion2016-04-30T13:42:00+00:00 19 MB 
[TXT]Super Fly Guy (Turtleback School & Library Binding Editi2016-05-01T11:01:00+00:00 22 MB 
[TXT]Behold, Jesus is Coming: Revelation (New Inductive Study)2016-05-02T08:20:00+00:00 25 MB 
[TXT]FTCE Math 6-12 (REA) - The Best Test Prep for the Florida Teacher Certification2016-05-03T05:39:00+00:00 19 MB 
[TXT]Manara Erotic Tarot Mini [Boxed Deck - Mini]2016-05-04T02:58:00+00:00 20 MB 
[TXT]Come Out and Play2016-05-05T00:17:00+00:00 23 MB 
[TXT]Rainbow Pictorial Chart Book - Birds2016-05-05T21:36:00+00:00 17 MB 
[TXT]List of MAK and BAT Values 2004 Maximum Concentrations and Biological Tolerance Values at the Workp2016-05-06T18:55:00+00:00 20 MB 
[TXT]Sports Encyclopaedia2016-05-07T16:14:00+00:00 21 MB 
[TXT]101 Science Projects2016-05-08T13:33:00+00:00 25 MB 
[TXT]Cursive Writing-Book, Part 12016-05-09T10:52:00+00:00 21 MB 
[TXT]The Da Vinci Legacy2016-05-10T08:11:00+00:00 17 MB 
[TXT]MS PowerPoint 20072016-05-11T05:30:00+00:00 21 MB 
[TXT]Power, Inc. The Epic Rivalry Between Big Business and Government- and the Reckoning That Lies Ahe2016-05-12T02:49:00+00:00 20 MB 
[TXT]India Since Independence 2nd Edition2016-05-13T00:08:00+00:00 24 MB 
[TXT]Sprinting for Fitness2016-05-13T21:27:00+00:00 20 MB 
[TXT]UGC Net Exam-Library & Information Science (Multiple Choice Objective Type Quest2016-05-14T18:46:00+00:00 25 MB 
[TXT]Sermons on Isaiah's Prophecy of the Death and Passion of Christ2016-05-15T16:05:00+00:00 25 MB 
[TXT]Education of Children With Hearing Impairment2016-05-16T13:24:00+00:00 25 MB 
[TXT]The Cost of Capital Intermediate Theory2016-05-17T10:43:00+00:00 22 MB 
[TXT]The Pocket Oxford Greek Dictionary2016-05-18T08:02:00+00:00 19 MB 
[TXT]Teaching and Assessing Skills in Computer Studies2016-05-19T05:21:00+00:00 17 MB 
[TXT]Advanced Accounting C.A. (P.E. II) New Syllabus2016-05-20T02:40:00+00:00 18 MB 
[TXT]Cities and Civilization2016-05-20T23:59:00+00:00 22 MB 
[TXT]Organisational Design and Development2016-05-21T21:18:00+00:00 18 MB 
[TXT]Adab AL-Qadi Islamic Legal and Judicial System2016-05-22T18:37:00+00:00 24 MB 
[TXT]Etoa Munda Won the Battle A Story About Tribal Life 4th Reprint2016-05-23T15:56:00+00:00 19 MB 
[TXT]Thimayya An Amazing Life2016-05-24T13:15:00+00:00 20 MB 
[TXT]Law of Sale of Goods and Hire Purchase (Sale of Goods Act, 1930; Hire Purchase Act, 1972)2016-05-25T10:34:00+00:00 24 MB 
[TXT]Advanced Cost and Management Accounting2016-05-26T07:53:00+00:00 22 MB 
[TXT]Manual on Design of Towers for Long Span River Crossing2016-05-27T05:12:00+00:00 21 MB 
[TXT]America on Record A History of Recorded Sound2016-05-28T02:31:00+00:00 22 MB 
[TXT]The Quality Revolution Best Practice from the World's L2016-05-28T23:50:00+00:00 23 MB 
[TXT]Total Quality Success Through People2016-05-29T21:09:00+00:00 22 MB 
[TXT]Frontiers of Ocular Pharmacology and Therapeutics2016-05-30T18:28:00+00:00 18 MB 
[TXT]Real Science What it is and What it Means2016-05-31T15:47:00+00:00 25 MB 
[TXT]National Information System Planning and Management2016-06-01T13:06:00+00:00 25 MB 
[TXT]Welding Processes and Technology 2nd Edition2016-06-02T10:25:00+00:00 19 MB 
[TXT]Thinking the Right Way2016-06-03T07:44:00+00:00 20 MB 
[TXT]Saints and Their Contribution in Classical Music2016-06-04T05:03:00+00:00 23 MB 
[TXT]The Problem of Linguistic Universals2016-06-05T02:22:00+00:00 24 MB 
[TXT]Microwave Engineering2016-06-05T23:41:00+00:00 20 MB 
[TXT]The Cambridge Companion to Mendelssohn2016-06-06T21:00:00+00:00 21 MB 
[TXT]An Ideal Personality2016-06-07T18:19:00+00:00 20 MB 
[TXT]Building Science and Planning2016-06-08T15:38:00+00:00 21 MB 
[TXT]Encyclopaedia of Bioinformatics2016-06-09T12:57:00+00:00 23 MB 
[TXT]Basic Principles of Natural and Medical Sciences in Vedas and Puranas2016-06-10T10:16:00+00:00 19 MB 
[TXT]Kids and Family Internet Guide2016-06-11T07:35:00+00:00 22 MB 
[TXT]An Introduction to The Geomorphology of India2016-06-12T04:54:00+00:00 20 MB 
[TXT]Computer-Aided Manufacturing In Accordance with U.P. Technical University Syllabus : A Degree Level2016-06-13T02:13:00+00:00 24 MB 
[TXT]Engineering Chemistry A Textbook for First Year Engineering Students2016-06-13T23:32:00+00:00 24 MB 
[TXT]Wavelets and Their Applications2016-06-14T20:51:00+00:00 25 MB 
[TXT]Algorithms and Artificial Systems2016-06-15T18:10:00+00:00 17 MB 
[TXT]Epidemiology and Culture2016-06-16T15:29:00+00:00 24 MB 
[TXT]Vegetable Oils Sources and Enhancement Research in India2016-06-17T12:48:00+00:00 24 MB 
[TXT]101 Great Indian Musicians and Dancers2016-06-18T10:07:00+00:00 19 MB 
[TXT]Ancient Middle Niger Urbanism and the Self-organizing Landscape2016-06-19T07:26:00+00:00 21 MB 
[TXT]Conservation2016-06-20T04:45:00+00:00 17 MB 
[TXT]Introduction to the Mathematical and Statistical Foundations of Econometrics2016-06-21T02:04:00+00:00 18 MB 
[TXT]Islam Its Politics and Spirituality2016-06-21T23:23:00+00:00 17 MB 
[TXT]Crisis of Socialism Notes in Defence of a Commitment2016-06-22T20:42:00+00:00 21 MB 
[TXT]Denial of Justice in International Law2016-06-23T18:01:00+00:00 21 MB 
[TXT]Hatha Yoga for Human Health2016-06-24T15:20:00+00:00 25 MB 
[TXT]The Films of Vincente Minnelli2016-06-25T12:39:00+00:00 18 MB 
[TXT]Competition and Monopoly in the Federal Reserve System, 19141951 A Microeconomic Approach to Monet2016-06-26T09:58:00+00:00 25 MB 
[TXT]Allama I.I. Kazi His Life and Thought2016-06-27T07:17:00+00:00 22 MB 
[TXT]The Demography of Victorian England and Wales2016-06-28T04:36:00+00:00 23 MB 
[TXT]Calculus of Finite Differences and Numerical Analysis (Allied Mathematics)2016-06-29T01:55:00+00:00 18 MB 
[TXT]Secularism in India Theory and Practice2016-06-29T23:14:00+00:00 24 MB 
[TXT]Dr. B.R. Ambedkar His Thoughts and Observations2016-06-30T20:33:00+00:00 21 MB 
[TXT]From Marxism to Democratic Socialism The Deeper Roots of Affinity2016-07-01T17:52:00+00:00 23 MB 
[TXT]Introductory Plant Virology For Graduate and Post Graduate Students of General Botany, Microbiology2016-07-02T15:11:00+00:00 21 MB 
[TXT]NGOs in Livelihood Improvement Nepalese Experience2016-07-03T12:30:00+00:00 23 MB 
[TXT]Dictionary of Power Systems and Electrical Engineering2016-07-04T09:49:00+00:00 22 MB 
[TXT]Globalisation and Sustainable Agriculture2016-07-05T07:08:00+00:00 18 MB 
[TXT]Methods of Educational Research2016-07-06T04:27:00+00:00 24 MB 
[TXT]Waqai-i Manazil-i Rum Tipu Sultan's Mission to Constantinople2016-07-07T01:46:00+00:00 23 MB 
[TXT]Monetary Economics2016-07-07T23:05:00+00:00 18 MB 
[TXT]MCQs in Human Anatomy Reprint2016-07-08T20:24:00+00:00 25 MB 
[TXT]Liberalisation, Globalisation and International Business2016-07-09T17:43:00+00:00 17 MB 
[TXT]Encyclopedia of Plant Diseases in Agriculture and Horticulture2016-07-10T15:02:00+00:00 18 MB 
[TXT]Supervision and Safety of Complex Systems2016-07-11T12:21:00+00:00 23 MB 
[TXT]Chapter VII (Trpti Dipa Prakaranam) Vol. 32016-07-12T09:40:00+00:00 25 MB 
[TXT]The Arena Man2016-07-13T06:59:00+00:00 19 MB 
[TXT]Junior Encyclopedia Human Body Question & Answers Book2016-07-14T04:18:00+00:00 19 MB 
[TXT]The Edge 50 Tips from Brands that Lead2016-07-15T01:37:00+00:00 22 MB 
[TXT]Retailing in India Emerging Trends2016-07-15T22:56:00+00:00 19 MB 
[TXT]Prophet of Bones A Novel Unabridged Edition2016-07-16T20:15:00+00:00 17 MB 
[TXT]Managing and Measuring Patients Satisfaction 1st Edition2016-07-17T17:34:00+00:00 18 MB 
[TXT]UGC-NET Digest on Paper II & III Physical Education2016-07-18T14:53:00+00:00 25 MB 
[TXT]Women's Social Rights and Entitlements2016-07-19T12:12:00+00:00 17 MB 
[TXT]The Planting of Christianity in Africa, Vol. II : To 18402016-07-20T09:31:00+00:00 19 MB 
[TXT]The Avram Davidson Treasury A Tribute Collection2016-07-21T06:50:00+00:00 20 MB 
[TXT]A Glimpse at the Back of the Book A Commentary on the Book of Revelation2016-07-22T04:09:00+00:00 25 MB 
[TXT]Farmer Duck2016-07-23T01:28:00+00:00 17 MB 
[TXT]Ocean Waves (A Quilting Mystery)2016-07-23T22:47:00+00:00 25 MB 
[TXT]Field Guide to the Little People A Curious Journey Into the Hidden Realm of Elves, Faeries, Hobgobl2016-07-24T20:06:00+00:00 20 MB 
[TXT]Letting the Light In Transforming Your Pain into Power2016-07-25T17:25:00+00:00 19 MB 
[TXT]My Listography My Amazing Life in Lists2016-07-26T14:44:00+00:00 21 MB 
[TXT]Stencil 101 Make Your Mark with 25 Reusable Stencils and Step-by-Step Instructions2016-07-27T12:03:00+00:00 20 MB 
[TXT]Tequila: Myth, Magic &am2016-07-28T09:22:00+00:00 18 MB 
[TXT]Life in Color Visual Therapy's Guide to the Perfect Palettefor Your Clo2016-07-29T06:41:00+00:00 19 MB 
[TXT]In My Nest Finger Puppet Book2016-07-30T04:00:00+00:00 22 MB 
[TXT]Porch Parties Cocktail Recipes & Easy Ideas for Outdoor Entertaining2016-07-31T01:19:00+00:00 18 MB 
[TXT]Fresh from the Farmers Market (Reissue): Year-Round Recipes for the Pick of the Crop2016-07-31T22:38:00+00:00 20 MB 
[TXT]Farts A Spotter's Guide2016-08-01T19:57:00+00:00 19 MB 
[TXT]The Doorbells of Florence Fictional Stories and Photographs2016-08-02T17:16:00+00:00 23 MB 
[TXT]The Country Cooking of Ireland2016-08-03T14:35:00+00:00 23 MB 
[TXT]Polk County, Georgia (GA) (Images of America)2016-08-04T11:54:00+00:00 17 MB 
[TXT]Design Research: The Store That Brought Modern Living to American Homes2016-08-05T09:13:00+00:00 18 MB 
[TXT]Bound to Be Bad (Ivy and Bean, Book 5)2016-08-06T06:32:00+00:00 22 MB 
[TXT]New York City Subway2016-08-07T03:51:00+00:00 18 MB 
[TXT]Talking to Tweens: Getting It Right Before It Gets Rocky with Your 8- to 12-Year-Old2016-08-08T01:10:00+00:00 19 MB 
[TXT]Chocolate Cakes 50 Great Cakes for Every Occasion2016-08-08T22:29:00+00:00 17 MB 
[TXT]Young Guns 6 and the Undiscovered Letter Vol. 12016-08-09T19:48:00+00:00 25 MB 
[TXT]Fuck You and Your Blog Journal2016-08-10T17:07:00+00:00 20 MB 
[TXT]Philadelphia Graveyards and Cemeteries (Images of America: Pennsylvania)2016-08-11T14:26:00+00:00 19 MB 
[TXT]Kitchen Sticky Notes Helpful Notes for the Home Cook2016-08-12T11:45:00+00:00 17 MB 
[TXT]The Little Books Boxed Set2016-08-13T09:04:00+00:00 18 MB 
[TXT]Mini Locker Notes2016-08-14T06:23:00+00:00 25 MB 
[TXT]1,001 Ways to Live in the Moment2016-08-15T03:42:00+00:00 24 MB 
[TXT]Eat Ate2016-08-16T01:01:00+00:00 18 MB 
[TXT]Scribble It! 30 Postcards2016-08-16T22:20:00+00:00 21 MB 
[TXT]Cupcake Shoppe Stationery2016-08-17T19:39:00+00:00 18 MB 
[TXT]Moma Modern Play Family2016-08-18T16:58:00+00:00 19 MB 
[TXT]Let's Bring Back...2016-08-19T14:17:00+00:00 23 MB 
[TXT]A Long Piece of String2016-08-20T11:36:00+00:00 17 MB 
[TXT]Stories for Bedtime A Keepsake Pocket and Tales to Cherish2016-08-21T08:55:00+00:00 20 MB 
[TXT]You Can Do It Too!2016-08-22T06:14:00+00:00 21 MB 
[TXT]In My Forest2016-08-23T03:33:00+00:00 23 MB 
[TXT]The Worst-Case Scenario Survival Handbook Gross Junior Edition2016-08-24T00:52:00+00:00 17 MB 
[TXT]Giant Pop-Out Safari A Pop-Out Surprise Book2016-08-24T22:11:00+00:00 19 MB 
[TXT]Touch (The Five Senses)2016-08-25T19:30:00+00:00 25 MB 
[TXT]Language in the Inner City: Studies in the Black English Vernacular (Conduct and Communication)2016-08-26T16:49:00+00:00 17 MB 
[TXT]Daily Life in the World of Charlemagne (Middle Ages)2016-08-27T14:08:00+00:00 23 MB 
[TXT]Everyday Life in Egypt in the Days of Ramesses The Great2016-08-28T11:27:00+00:00 21 MB 
[TXT]The Spoken Word and the Work of Interpretation (Conduct and Communication)2016-08-29T08:46:00+00:00 22 MB 
[TXT]History Begins at Sumer Thirty-Nine Firsts in Recorded History 3rd Edition2016-08-30T06:05:00+00:00 19 MB 
[TXT]Enterprising Women Television Fandom and the Creation of Popular Myth2016-08-31T03:24:00+00:00 17 MB 
[TXT]Dangerous Men and Adventurous Women Romance Writers on the Appeal of the Romance2016-09-01T00:43:00+00:00 21 MB 
[TXT]Before Columbus Exploration and Colonization from the Mediterranean to the Atlantic, 1229-14922016-09-01T22:02:00+00:00 20 MB 
[TXT]Aquinas and the Jews2016-09-02T19:21:00+00:00 17 MB 
[TXT]Beyond the Red Notebook: Essays on Paul Auster (Penn Studies in Contemporary American Fiction)2016-09-03T16:40:00+00:00 20 MB 
[TXT]The Heartland Chronicles2016-09-04T13:59:00+00:00 24 MB 
[TXT]Indian Literature in English Translation2016-09-05T11:18:00+00:00 18 MB 
[TXT]Phycology-Nature and Nuriture2016-09-06T08:37:00+00:00 21 MB 
[TXT]History of Journalism2016-09-07T05:56:00+00:00 21 MB 
[TXT]Jammu and Kashmir Charting a Future2016-09-08T03:15:00+00:00 22 MB 
[TXT]Defence Policy of India [Nehru to Manmohan]2016-09-09T00:34:00+00:00 22 MB 
[TXT]Birds of Himalaya and Kashmir2016-09-09T21:53:00+00:00 21 MB 
[TXT]Strategies for Performance Management2016-09-10T19:12:00+00:00 25 MB 
[TXT]Street Children and the Child Labour2016-09-11T16:31:00+00:00 20 MB 
[TXT]Problems of Slums and Viable Strategies for Development2016-09-12T13:50:00+00:00 22 MB 
[TXT]Social Cognition and Communalism2016-09-13T11:09:00+00:00 18 MB 
[TXT]Introductory Quantum Mechanics and Spectroscopy2016-09-14T08:28:00+00:00 23 MB 
[TXT]Dynamics of Creativity and Interests Engineers Verses Civil Servants2016-09-15T05:47:00+00:00 23 MB 
[TXT]Solution to Problems Financial Accounting, HP2016-09-16T03:06:00+00:00 25 MB 
[TXT]Economics of Asymmetric Information2016-09-17T00:25:00+00:00 17 MB 
[TXT]Modern Women and the Society2016-09-17T21:44:00+00:00 25 MB 
[TXT]Management of Health Education Programme2016-09-18T19:03:00+00:00 24 MB 
[TXT]Camping Management in Physical Education2016-09-19T16:22:00+00:00 22 MB 
[TXT]Record of Yoga2016-09-20T13:41:00+00:00 18 MB 
[TXT]Language in Contemporary India2016-09-21T11:00:00+00:00 23 MB 
[TXT]UGC (NET) Manual for Library and Information Science Paper II Objective Questions and Paper III : D2016-09-22T08:19:00+00:00 25 MB 
[TXT]Vitality of East Asian Christianity Challenges to Mission and Theology in Japan2016-09-23T05:38:00+00:00 19 MB 
[TXT]DDC 22 A Practical Approach2016-09-24T02:57:00+00:00 22 MB 
[TXT]Concept of Suffering in Buddhism 1st Published2016-09-25T00:16:00+00:00 24 MB 
[TXT]Citriculture2016-09-25T21:35:00+00:00 20 MB 
[TXT]Introduction to Operating System2016-09-26T18:54:00+00:00 21 MB 
[TXT]Elementary Income Tax AP2016-09-27T16:13:00+00:00 21 MB 
[TXT]Education on Internet Programming2016-09-28T13:32:00+00:00 21 MB 
[TXT]Introduction to Chemical Equipment Design Mechanical Aspects2016-09-29T10:51:00+00:00 22 MB 
[TXT]Environment and Pollution Education2016-09-30T08:10:00+00:00 18 MB 
[TXT]Human Resource Development Theory and Practice2016-10-01T05:29:00+00:00 24 MB 
[TXT]Epicentre of Violence Partition Voices and Memories from Amritsar2016-10-02T02:48:00+00:00 23 MB 
[TXT]Rasa-Jala-Nidhi or Ocean of Indian Chemistry and Alchemy With English Translation2016-10-03T00:07:00+00:00 25 MB